(data stored in SCRATCH zone)

EMBL: CP002293.PE144

CP002293.PE144       Location/Qualifiers
FT   CDS_pept        153393..153785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0144"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: gwc:GWCH70_0145
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73000"
FT                   /db_xref="GOA:A0A0F6BHU9"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU9"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ADP73000.1"
FT                   /translation="MAQVQYYGTGRRKTSVARVRLVPGDGRIVINDRDIRDYIPSEALI
FT                   EIVKQPLVLTETLGNYDVLVNVKGGGFSGQAGAIRHGIARALLQVDPDYRPILKRAGLL
FT                   TRDARVKERKKYGLKGARRAPQFSKR"
     ttggcacaag tacaatacta tggcacaggt cgtcgtaaaa cctctgtcgc gcgtgtacgt        60
     ctagttcctg gtgacggacg cattgtgatt aacgatcgcg acattcgtga ttatattccg       120
     tcagaagcat tgatcgagat tgtaaaacaa ccgctagtgt taacggaaac gttgggaaat       180
     tatgatgtat tagtgaacgt taaaggcggc ggattctccg gtcaagcagg cgcgattcgc       240
     cacggaatcg ctcgcgcgtt attgcaagta gatccagatt atcgcccaat attaaaacgc       300
     gcaggcttat taacgcgcga tgctcgtgtg aaagaacgca aaaaatacgg tctcaaaggt       360
     gctcgtcgcg cgccacaatt ctcgaaacgt taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page