(data stored in ACNUC7421 zone)

EMBL: CP002293.PE145

CP002293.PE145       Location/Qualifiers
FT   CDS_pept        153897..154337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0145"
FT                   /product="Protein of unknown function DUF2521"
FT                   /note="PFAM: Protein of unknown function DUF2521; KEGG:
FT                   gwc:GWCH70_0146 conserved hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73001"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV0"
FT                   /inference="protein motif:PFAM:PF10730"
FT                   /protein_id="ADP73001.1"
FT                   /translation="MNVITSFKKKKQEKQMLYERKMLRELSLERLKTQAIEHFSPLYRI
FT                   YRAFSSVIEEGCIDIAIEAYLLGANYSRFGYYGEPAEFVKRRCAQEEKYLIDALFDFLC
FT                   FWGNIGDGLADESLYLACEHYIAYWWMEGFEKGKKRRRLKLH"
     atgaatgtca ttacttcatt taaaaaaaag aaacaggaaa aacaaatgtt atatgaacga        60
     aaaatgttgc gtgagttgtc tctcgaaagg ctgaaaacgc aggcaatcga gcattttagt       120
     ccgctttatc gcatataccg cgcattctcc tccgtcattg aagaaggatg cattgatatc       180
     gcgatcgaag catatttgct tggggccaac tacagccggt ttggttatta cggagaacca       240
     gcggaatttg ttaagcggcg atgcgcccaa gaagagaaat atttgattga tgcattattt       300
     gattttcttt gcttttgggg aaacatcggc gacggattgg cggatgagtc gctttatttg       360
     gcgtgtgaac actatattgc ttattggtgg atggaaggat ttgaaaaagg aaaaaagcgc       420
     cgccgtctta aacttcattg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page