(data stored in SCRATCH zone)

EMBL: CP002293.PE146

CP002293.PE146       Location/Qualifiers
FT   CDS_pept        154404..155111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0146"
FT                   /product="N-acetylmuramoyl-L-alanine amidase CwlD"
FT                   /note="TIGRFAM: N-acetylmuramoyl-L-alanine amidase CwlD;
FT                   PFAM: cell wall hydrolase/autolysin; KEGG: gwc:GWCH70_0147
FT                   N-acetylmuramoyl-L-alanine amidase CwlD; SMART: cell wall
FT                   hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73002"
FT                   /db_xref="GOA:A0A0F6BHV1"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV1"
FT                   /inference="protein motif:TFAM:TIGR02883"
FT                   /protein_id="ADP73002.1"
FT                   /translation="MKTKWLAALMSSIIVIVLFQYIFANTTSTKSWNLPLSGRIIVLDP
FT                   GHGGPDGGAVGGDVVEEEVALKVAEKLRDYLQQQGALVLMTREMDSDLADKDTRGYRRR
FT                   KVEDLRKRVALINESEADLFISIHLNAIPSPRWRGAQTFYYGSLLENERLAKFIQAELR
FT                   RNLENTDRVAKRIDTVYLLKYAKKPGALVEVGFLSHPEERELLASDRYQTKLAAAVYKG
FT                   VLRYFSNEKNPPE"
     atgaaaacaa aatggttggc cgctctcatg agttccataa ttgttattgt tcttttccaa        60
     tatatctttg cgaatacgac ttcaaccaaa tcatggaatc ttccgctctc aggaaggatt       120
     atcgttttag accctggcca tggcggaccg gacggaggag cagtcggcgg tgacgttgtt       180
     gaagaagaag tggcgctgaa agtagcggag aaattgcgtg actatttgca gcagcaaggt       240
     gcgctcgtgt tgatgacaag ggagatggat agcgaccttg ctgataaaga cacgcgtggt       300
     tacagacggc gaaaagtaga ggatttgcga aagcgcgtcg cgttgattaa tgaatcggag       360
     gcggatttat ttattagcat ccatcttaat gccattcctt ctccgcgttg gcgtggagcg       420
     caaacatttt attacggttc gctgttagaa aatgagcgtc ttgcgaagtt tattcaagcg       480
     gaactgcggc gcaatttgga aaatacggat cgtgttgcaa aacggattga tacggtttat       540
     ttgctgaagt atgcgaaaaa gccaggtgcg cttgtcgaag ttggttttct gtctcatccg       600
     gaagaaaggg agctgctggc ttccgatcgt tatcaaacaa agctggctgc agcggtatac       660
     aaaggcgtct tgcggtattt ttccaatgaa aaaaatcctc ccgaatag                    708
//

If you have problems or comments...

PBIL Back to PBIL home page