(data stored in ACNUC7421 zone)

EMBL: CP002293.PE148

CP002293.PE148       Location/Qualifiers
FT   CDS_pept        complement(156277..156873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0148"
FT                   /product="spore germination protein GerD"
FT                   /note="KEGG: gwc:GWCH70_0149 spore germination protein
FT                   GerD"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73004"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV3"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0149"
FT                   /protein_id="ADP73004.1"
FT                   /translation="MKKSTLLLLFSYFLILGSCAPQDISPPPPDYDQTKKMVVDILKTD
FT                   EGKKAIQEIMADEKVKQQLVIEQAVVKETLQQVLTSEKGIKFWEKAMQDPKFAESFAKS
FT                   LKTEQEKTIKALMKDPEYQGMMIDILKNPEMEKAMTDVLKSKQFRQHLQQVITETLNSP
FT                   LFQAKIQDILVKSAENIQQETKKQNEDQDETNSNQ"
     atgaaaaaaa gcacattgct cctcttattt agttatttcc ttatccttgg ctcttgcgcc        60
     ccccaagata ttagcccgcc tcccccagat tatgaccaaa cgaaaaaaat ggtcgtcgat       120
     attttaaaaa cggatgaggg gaaaaaggcg attcaggaaa ttatggcgga tgaaaaggtg       180
     aaacagcaat tagtcatcga gcaagctgtt gtcaaagaaa cactccaaca agtgctgaca       240
     tcagaaaaag gcataaaatt ttgggaaaaa gcgatgcaag atccaaagtt tgctgaaagc       300
     tttgccaaaa gtttgaaaac ggagcaagaa aaaacgatca aagcattaat gaaagaccct       360
     gaatatcaag ggatgatgat agatatttta aaaaatccag aaatggaaaa agcaatgacg       420
     gatgtgttaa aaagcaaaca attccgccaa caccttcaac aagtcatcac agaaacgctg       480
     aacagtcctt tgtttcaagc aaaaattcaa gacatattgg tcaaatcggc tgaaaacata       540
     caacaagaga caaaaaagca aaatgaagat caagatgaaa caaacagcaa tcagtaa          597
//

If you have problems or comments...

PBIL Back to PBIL home page