(data stored in SCRATCH zone)

EMBL: CP002293.PE149

CP002293.PE149       Location/Qualifiers
FT   CDS_pept        157030..157635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0149"
FT                   /product="KinB signaling pathway activation protein"
FT                   /note="KEGG: gwc:GWCH70_0151 KinB signaling pathway
FT                   activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73005"
FT                   /db_xref="GOA:A0A0F6BHV4"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV4"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0151"
FT                   /protein_id="ADP73005.1"
FT                   /translation="MNSRKWVRLFLTTLAIGGITTAVIGVILNWGEYEKLFLRMDVLEF
FT                   AAVLMWHIGVGFIFSIISQMGFFAYLTIHRFGLGVFRSASLWNSVQIVLILFVLFDLVY
FT                   FRYQVFAVKGESVVGYILIALFILVAGLVVAYVKSAQTNRGAFIPALFFMVVVTVIEWF
FT                   PALRINDKDWLYLMLFPLLICNAYQLLILHKLTGVAKS"
     gtgaacagcc ggaaatgggt gcgtttattt ttaacaacat tggcgattgg cggtataacg        60
     acagcagtga tcggcgttat acttaactgg ggggaatatg agaagctgtt tttgcgaatg       120
     gacgtattgg aattcgcggc ggtgttaatg tggcacatcg gtgtcggatt tatttttagc       180
     atcataagtc aaatggggtt tttcgcttat ttaactattc atcgctttgg gcttggagta       240
     ttccgctctg cctctctttg gaattcagtg cagattgtgt tgattttgtt tgtgcttttc       300
     gatttagtgt atttccgtta tcaagtgttt gcagtgaaag gagagtctgt tgttggctac       360
     atactaatcg ctttatttat tttggttgct gggcttgttg ttgcttatgt taaaagcgcc       420
     caaacgaata gaggagcgtt tataccggcg ctgtttttta tggttgtcgt aacggtgatc       480
     gaatggtttc cggcattgcg cattaacgat aaagattggc tttatttaat gttatttcca       540
     ttattaattt gcaacgctta tcagcttctt atactgcata aactaactgg tgttgcaaag       600
     tcataa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page