(data stored in ACNUC7421 zone)

EMBL: CP002293.PE15

CP002293.PE15        Location/Qualifiers
FT   CDS_pept        complement(24208..24843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0015"
FT                   /product="deoxynucleoside kinase"
FT                   /note="PFAM: deoxynucleoside kinase; KEGG: gwc:GWCH70_0016
FT                   deoxynucleoside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72871"
FT                   /db_xref="GOA:A0A0F6BHH0"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH0"
FT                   /inference="protein motif:PFAM:PF01712"
FT                   /protein_id="ADP72871.1"
FT                   /translation="MGMVPFIAIEGPIGVGKTSLAKAISEHFHYHLVKEIVDENPFLGK
FT                   FYENIEEWSFQTEMFFLCHRYKQLEEIDRDFLQRQQPVVTDYHIMKNLIFAKRTLKIHH
FT                   YKKYTKIYDILTDGLPQPNMIIYLHASLETLLTRIQQRGRDFEKRMDPVYLQQLSADYE
FT                   EAFSLFEQANPHIPVLRFNGDLLDFVQREEDLHYIFERVKTVVKGVSQ"
     atgggaatgg tcccatttat cgcgatagaa ggaccgattg gagttgggaa aacttcattg        60
     gcaaaagcaa tttctgaaca ttttcattat catttagtga aagaaatcgt tgacgagaat       120
     ccatttctcg ggaaatttta tgaaaatatc gaagaatgga gcttccaaac agaaatgttt       180
     ttcctttgcc accgttataa gcaattagaa gaaattgacc gtgattttct gcaacgacaa       240
     caaccggttg tcaccgatta tcatataatg aaaaatctaa tttttgctaa aagaacatta       300
     aaaatccatc actacaaaaa atatacaaaa atctatgata ttttaacgga cggtctacct       360
     caaccaaata tgattattta tttacatgcc agccttgaaa cgctattaac gcgcattcag       420
     caacgaggtc gcgattttga aaaaagaatg gatccggtct acttgcaaca gctatccgct       480
     gattatgaag aagcgttttc tctattcgaa caagcaaatc cacatattcc agttcttcgg       540
     ttcaacggag acttgcttga tttcgttcaa cgggaagaag atttacatta catattcgaa       600
     cgagtaaaaa ctgtcgtaaa aggggtttcg caatga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page