(data stored in ACNUC7421 zone)

EMBL: CP002293.PE151

CP002293.PE151       Location/Qualifiers
FT   CDS_pept        158572..158739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73007"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP73007.1"
FT                   /translation="MKHILRFCFSVMAKMLKEFRKRCKKKGVKAIPFFVVQLRNGEGIF
FT                   SIRQNVDKKH"
     atgaaacata ttttgcggtt ttgcttttcg gtgatggcca aaatgctgaa ggagttccgg        60
     aaacgttgta aaaagaaagg ggtaaaagca attccttttt ttgtggtcca attacggaac       120
     ggtgagggga tttttagcat tcggcaaaac gttgataaaa agcattga                    168
//

If you have problems or comments...

PBIL Back to PBIL home page