(data stored in SCRATCH zone)

EMBL: CP002293.PE152

CP002293.PE152       Location/Qualifiers
FT   CDS_pept        165552..166472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0152"
FT                   /product="arginase"
FT                   /note="KEGG: gwc:GWCH70_0153 arginase; TIGRFAM: arginase;
FT                   PFAM: Arginase/agmatinase/formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73008"
FT                   /db_xref="GOA:A0A0F6BHV7"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV7"
FT                   /inference="protein motif:TFAM:TIGR01229"
FT                   /protein_id="ADP73008.1"
FT                   /translation="MERGNSVKKVSIIGVPMDLGQTRRGVDMGPSAMRYAGIIERLERL
FT                   HYEIEDLGDVSIGKMEWSDDEGLRLNLRNLKAVAKTNEKLAEMVDDVVQRGRFPLVLGG
FT                   DHSIAIGTLAGVAKHYQNLGVIWYDAHGDLNTAETSPSGNIHGMSLAVCLGLGHPYLTK
FT                   IGGYSPKVKPENVVLIGVRSLDEGEKQLIREKGIKVYTMHEVDRLGMAAVMEETIAYLQ
FT                   GRTDGVHLSLDLDGLDPHDAPGVGTPVIGGLTYRESHLAMEMLAEAQLITSAEFVEVNP
FT                   ILDERNKTASVAVGLMGSLFGEKLV"
     atggaaaggg gaaacagtgt gaagaaagta tcgatcattg gagtgccaat ggatttaggg        60
     cagacacgcc gcggtgtgga tatggggccg agcgccatgc gttatgcagg aatcatcgag       120
     aggctggaac gccttcatta tgagattgaa gatttgggcg atgtttcaat tggaaaaatg       180
     gaatggtctg atgatgaagg gttacggctt aatttgcgca atttgaaagc ggttgcaaaa       240
     acaaatgaaa aattggcgga gatggtggac gatgtagtcc aaagaggtcg ctttcctctt       300
     gtgcttggcg gcgaccatag cattgccatc gggacattag ctggtgtcgc aaagcattat       360
     caaaatttgg gagttatttg gtatgatgcc catggcgatt taaatacagc ggaaacttct       420
     ccgtcaggga atattcatgg gatgtcgctc gctgtgtgcc ttggtttggg gcatccatat       480
     ttgacgaaga tcggcggata cagtccaaaa gtaaaaccgg aaaatgttgt tcttattggt       540
     gtccgttctc ttgatgaagg ggaaaaacaa ttaatccgtg aaaaggggat taaggtatat       600
     acgatgcatg aagtagatcg cctcggaatg gcggctgtga tggaggaaac gattgcttat       660
     ttgcaaggac ggacagacgg cgtgcattta tctcttgatt tagatgggct tgatccgcac       720
     gatgctccgg gagtgggcac gccggttatc gggggcctta cttatcgcga aagccatttg       780
     gcaatggaaa tgcttgcaga agcgcaacta attacatcag cagaatttgt agaagtgaat       840
     ccgattttag atgaacggaa taagactgct tccgtcgcgg tgggattgat ggggtccctt       900
     tttggagaaa aattagtgta g                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page