(data stored in ACNUC7421 zone)

EMBL: CP002293.PE153

CP002293.PE153       Location/Qualifiers
FT   CDS_pept        166631..167194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0153"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: gwc:GWCH70_0154 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma-W
FT                   factor; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   sigma-70 region 2 domain protein; Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73009"
FT                   /db_xref="GOA:A0A0F6BHV8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014294"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV8"
FT                   /inference="protein motif:TFAM:TIGR02948"
FT                   /protein_id="ADP73009.1"
FT                   /translation="MEIFVKKRIKAIKKGDQNAYADIVDLYKDKIYRLCYRMLGNRHEA
FT                   EDTAQEAFIRAYVNIHTYNPNMKFSSWLYRIATNLAIDKIRKKKPDAYLDEEISGTDGL
FT                   TMYSQLSSSEASPEETLESLELQETVQKAIEKLPEKYRSVIVLRYIEDLSLQEISEILD
FT                   LPLGTVKTRIHRGREALRKHLGHL"
     atggagatat tcgtgaaaaa gcgcatcaaa gcgatcaaaa aaggggatca aaatgcttac        60
     gccgatattg tagaccttta caaagacaaa atataccgtt tatgttaccg gatgctcgga       120
     aaccgccacg aggcggaaga tactgctcaa gaggcgttta ttcgcgctta tgttaatatt       180
     catacgtata atccaaacat gaagttttct tcatggctgt accgaattgc caccaattta       240
     gcgattgata aaattcgcaa gaaaaaaccc gatgcctatt tagacgaaga gataagcggc       300
     acagacggac ttacgatgta ttcgcagctt tcctctagcg aagcttctcc ggaagaaaca       360
     ttagaaagct tggaactgca ggaaaccgtg caaaaagcga ttgaaaagct tcctgaaaag       420
     tatcgaagcg ttattgtatt aaggtatata gaagatttat cgttgcagga gattagcgaa       480
     attttggatt tgccgctcgg caccgtcaaa acaagaattc atcgcggcag ggaagcgttg       540
     cgaaagcatt tgggccattt atga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page