(data stored in ACNUC7421 zone)

EMBL: CP002293.PE157

CP002293.PE157       Location/Qualifiers
FT   CDS_pept        170002..171348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0157"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="KEGG: gwc:GWCH70_0158 phosphoglucosamine mutase;
FT                   TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73013"
FT                   /db_xref="GOA:A0A0F6BHW2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHW2"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ADP73013.1"
FT                   /translation="MGKYFGTDGVRGVANRELTPELAFKIGRCGGYVLTKSEKRPKVLI
FT                   GRDTRISGHMLEGALVAGLLSIGAEVMRLGVISTPGVAYLTKALGAQAGIMISASHNPV
FT                   QDNGIKFFGPDGFKLSDEQEQEIEALIDSPEDMLPRPIGEALGQVNDYFEGGQKYLQYL
FT                   KQTIDEDFSGIKIALDCAHGATSSLATHLFADLEADVVTMGASPNGININEGVGSTHPE
FT                   ALAAFVKEKGADVGLAFDGDGDRLIAVDEYGNIVDGDQIMYICAKYLKEIGRLKQQTVV
FT                   STVMSNLGFYKALEAQGIQSVQTAVGDRYVVEEMRKNGYNLGGEQSGHIIFLDYNTTGD
FT                   GLLTALQLVNIMKIKEKPLSELASEVKKYPQLLVNVKVADKHKVMENEKVKAVIQEVEK
FT                   EMSENGRVLVRPSGTEPLVRVMVEAPTEETCRNYVERIASVIREEMGTE"
     atgggtaaat attttggtac tgacggcgtt cgcggagtcg cgaatcgcga gttgacaccg        60
     gaactggcat ttaaaattgg ccgctgcgga ggctatgtat tgaccaaaag cgaaaaacgg       120
     ccaaaagtat tgattggccg tgatacacgt atttctggac atatgcttga aggggcgctt       180
     gtcgccggat tgctttcgat tggggcggaa gtaatgcgcc ttggcgtgat ttccacccca       240
     ggcgttgctt atttgacaaa agcattggga gcgcaagccg gaattatgat ttccgcatca       300
     cataaccctg ttcaagacaa tggaattaag ttttttggcc cagacggttt taaactttct       360
     gatgaacaag aacaagaaat tgaagcgctg attgatagcc cggaagatat gctgccaagg       420
     ccgatcggag aagcgttggg gcaagtgaat gattattttg aaggcggcca aaagtatttg       480
     cagtacttaa aacagacgat tgacgaagat ttttcgggaa tcaaaattgc gcttgattgt       540
     gcgcatgggg ccacttcgtc ccttgccacc catttattcg ctgatttaga agcggatgtt       600
     gtgacaatgg gcgcatcgcc gaatggcatt aacattaacg aaggcgttgg ctcgacccat       660
     ccggaagcgt tagcggcatt tgttaaagaa aaaggcgcag acgtcgggct cgcctttgat       720
     ggcgacgggg accgcctgat tgcggtagat gaatacggaa atattgtgga tggcgatcaa       780
     attatgtaca tttgtgcgaa atatttaaaa gaaattggcc gtcttaaaca gcaaacggtc       840
     gtttccaccg tgatgagcaa tctcggattt tacaaagccc ttgaagcgca agggatccaa       900
     agtgtgcaaa cggctgtcgg cgaccgttac gtcgtggagg aaatgaggaa aaatggatat       960
     aacttaggcg gagaacaatc ggggcatatt attttccttg attacaatac gacaggagat      1020
     gggctgctga cggcgctgca gcttgttaat attatgaaaa tcaaagaaaa gccgctttct      1080
     gagcttgcaa gtgaagtgaa aaaatatccg cagctgcttg tgaatgtgaa agtggccgat      1140
     aaacataaag tgatggaaaa cgaaaaagtg aaagccgtaa ttcaagaagt ggaaaaagaa      1200
     atgagcgaaa acggccgcgt tcttgtccgt ccgtccggaa cggaaccgct tgtgcgcgtg      1260
     atggtggaag caccgacgga agaaacatgc cggaactatg ttgaacggat tgcctctgtc      1320
     attcgcgagg aaatgggaac agagtaa                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page