(data stored in ACNUC7421 zone)

EMBL: CP002293.PE16

CP002293.PE16        Location/Qualifiers
FT   CDS_pept        complement(24941..26227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0016"
FT                   /product="glycoside hydrolase family 18"
FT                   /note="KEGG: gwc:GWCH70_0017 glycoside hydrolase family 18;
FT                   PFAM: glycoside hydrolase family 18; Peptidoglycan-binding
FT                   lysin domain; SMART: chitinase II; Peptidoglycan-binding
FT                   LysM"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72872"
FT                   /db_xref="GOA:A0A0F6BHH1"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR041704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH1"
FT                   /inference="protein motif:PFAM:PF00704"
FT                   /protein_id="ADP72872.1"
FT                   /translation="MQIHVVQRGQTLSGIAQAYNTTPEEIIQANDLPNPDNLVVGQAIV
FT                   IPIVGRFYWVLRGDSLWSISRRFSIPMQQLAQINRISLDSPLQVGQRLYIPPRTKRRAE
FT                   FNGYIEPRGTAVSPALEASARQAAPHLTYLAPFHFQIQRNATLKEPPLNNFPSIARANG
FT                   VTLMMVVTNIENEQFSDELGALILNNEQLQNRLLDNITTIAKKYGFHDIHFDMEYLRPE
FT                   DREAYNAFLRKAKQRFGREGWLLSTALAPKTSATQKGRWYEAHDYRAHGQIADFVIIMT
FT                   YEWGYSGGPPMAVSPIGPVRRVLEYAISEIPASKIMMGQNLYGYDWTLPYVPGGPYAQA
FT                   ISPQQALRLASQHNVTIEYDANAQAPHFRYRDESGKEHEVWFEDARSIQAKFNLVKELG
FT                   LRGMSYWKLGLDFPQNWLLLTDNFTVVKK"
     atgcaaattc acgtcgtaca aagagggcag acgttaagcg gaattgctca agcgtataat        60
     acgactccgg aagaaatcat tcaggcaaac gatcttccaa atccagacaa ccttgtcgtc       120
     ggtcaagcga ttgtcattcc gattgttggc cgtttttatt gggttttgcg cggtgatagc       180
     ttatggtcca tttcccgcag attttccatt cctatgcagc agcttgcaca aattaaccgc       240
     atttccctcg atagtccgtt gcaagttgga cagcgtttat atattcctcc aaggacaaaa       300
     cggagagctg agtttaacgg atacattgaa ccgcgcggaa cggctgtcag cccagcgctg       360
     gaagcaagcg ctcgccaagc tgccccgcat ttaacctatt tagctccgtt tcactttcaa       420
     atccagcgaa atgcaacact caaagaacca ccattaaata atttcccatc tatcgcccgt       480
     gccaatggcg ttacgttaat gatggtcgtt accaacatcg aaaacgaaca gttcagcgat       540
     gagctaggag ccctcatttt aaataacgaa caattacaaa accgcttatt ggataacata       600
     acaaccatag cgaaaaaata cggatttcat gatattcact ttgatatgga atatttgcgt       660
     cctgaagacc gggaagcgta taacgcgttt ttgcgaaaag caaagcagcg gtttggacgc       720
     gaaggctggc tgttgtccac cgccctagcc ccaaaaacga gcgcgacaca aaagggacgc       780
     tggtatgaag cgcatgatta ccgcgcccat ggccaaattg ctgactttgt catcattatg       840
     acatacgaat ggggatatag cggcggaccg ccaatggctg tttctccaat cggtcctgtt       900
     cggcgcgtgc tggaatatgc catttccgaa atacctgctt ctaaaattat gatgggacaa       960
     aacctgtacg gatacgattg gacgcttcca tacgtaccgg gcggaccata tgcgcaggcg      1020
     attagcccgc agcaagcgct ccgtcttgcc tcccaacata acgtcaccat tgaatatgac      1080
     gcaaacgcgc aagctcccca ttttcgttat cgagatgaaa gcggaaaaga acatgaagtg      1140
     tggtttgaag atgcccgctc gattcaagca aaattcaact tagtaaaaga gcttggccta      1200
     cgtggaatga gctattggaa actaggatta gattttccac aaaattggtt gctattaaca      1260
     gataacttta cagttgtaaa aaaataa                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page