(data stored in ACNUC7421 zone)

EMBL: CP002293.PE160

CP002293.PE160       Location/Qualifiers
FT   CDS_pept        175582..176475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0161"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: gka:GK0170 AraC/XylS family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73016"
FT                   /db_xref="GOA:A0A0F6BHW5"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHW5"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADP73016.1"
FT                   /translation="MRTVNYQRIIQKAINYIEDNLHESLTLENIASYAGFSKYHFLRIF
FT                   QKETGITVGDYVRIRRLASAASMLLYTDESIINIAYYFRFGTQESFTRAFKKVYHMPPG
FT                   QYRRIMSSIINKNGGKNMKQQQQIKGWFLSGSHPFNYEMGIDTKEVHQGKCSGYLKSVT
FT                   VQSADEFATMMQQFKAEKFLGKRVKLSAFVKTKNVEGFCGLWMRVDNALNDVLQFDNMS
FT                   DRPIVKDTNWNLYSIVLDVPENSALISFGVLLSGKGHVWVDQFKFEEVDKSVPTTNLEI
FT                   AYDVLDEPINLSFEEE"
     gtgcggacgg tgaattatca gcgaataata cagaaagcca ttaattatat tgaggataac        60
     ttacacgaat ctcttacatt agaaaacatt gcttcctatg ctggtttctc gaaataccat       120
     ttccttagaa tttttcagaa ggaaaccggg ataacagttg gtgattacgt gcggattaga       180
     agactagcta gcgctgctag tatgctgctt tatacggatg agtcgattat taacatcgct       240
     tattattttc gatttggaac gcaagaatct tttacaagag cttttaagaa agtttatcat       300
     atgccgccgg gacaataccg ccggattatg agttcaatta ttaataaaaa tggagggaag       360
     aatatgaaac aacagcagca aataaaaggc tggtttttga gcggaagcca tccattcaat       420
     tatgaaatgg gaattgatac gaaagaagtc catcaaggaa aatgctcagg ctatttaaaa       480
     tccgtaacgg ttcaatcagc tgatgaattc gcgacaatga tgcaacagtt caaagcggaa       540
     aaatttttag ggaaacgagt aaagctctct gcttttgtta aaacaaaaaa tgtggaaggt       600
     ttttgcggtt tatggatgcg agtcgataac gctttaaatg atgtgcttca atttgataac       660
     atgagcgacc ggccgattgt aaaagatacg aattggaatt tatactccat tgttcttgat       720
     gtcccggaaa acagcgccct tatttccttt ggcgttctgc tctcgggcaa ggggcatgtt       780
     tgggtcgatc aatttaaatt tgaggaagtg gataaaagtg tgcctactac caatctcgaa       840
     atagcctatg atgttctcga tgaaccgata aacttatctt ttgaggagga atga             894
//

If you have problems or comments...

PBIL Back to PBIL home page