(data stored in ACNUC7421 zone)

EMBL: CP002293.PE162

CP002293.PE162       Location/Qualifiers
FT   CDS_pept        179748..180401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0165"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="KEGG: bat:BAS4107 HAD superfamily hydrolase;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; HAD-superfamily hydrolase, subfamily IA, variant 1;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73018"
FT                   /db_xref="GOA:A0A0F6BHW7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHW7"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ADP73018.1"
FT                   /translation="MIKAIIFDFDGLIVDTETAWFEAYKETMSLYKVDLPLERFVECVG
FT                   SDNTALYEFFKQQLGESCDIAEIEAKAKSLYKIKMKTPQAREGVKDYLEEAKKWGYKIA
FT                   IASSSTKEWVTHYLKELGLLHYFEVMITQDDVDKVKPAPDLYLKAVDALNISPNEALAF
FT                   EDSLNGLQAALAAGLKCVIVPNPVTESLPFENYDLRLTSMTEKRFIDVIKQIEQ"
     ttgataaaag caattatttt tgattttgat ggtttaattg ttgacactga gacggcctgg        60
     tttgaggcgt ataaagaaac tatgagctta tataaggtcg atttgcctct tgaacgtttt       120
     gtcgaatgtg ttggatctga taatactgcc ctttacgagt ttttcaaaca acagcttggg       180
     gaaagttgcg acattgcaga aattgaggca aaagccaaaa gcttgtacaa aataaagatg       240
     aaaacccctc aggcacgtga aggtgtaaag gattacttag aagaagcaaa aaaatggggc       300
     tacaaaattg ccattgcttc aagctcaacg aaggagtggg taactcatta tttaaaggaa       360
     cttggactgt tgcactattt tgaagttatg atcacacaag atgatgttga taaagtaaaa       420
     ccagcccccg atttgtattt aaaagcagtt gatgccttaa acatcagccc caatgaagca       480
     ttagcctttg aagattcctt gaacgggctc caagctgctt tagcggctgg attaaagtgt       540
     gtcattgttc caaatccagt cacagagtcc ttgccctttg aaaattatga tttgcggctt       600
     acatcgatga cagaaaagcg tttcattgat gtcataaaac agattgagca ataa             654
//

If you have problems or comments...

PBIL Back to PBIL home page