(data stored in ACNUC7421 zone)

EMBL: CP002293.PE163

CP002293.PE163       Location/Qualifiers
FT   CDS_pept        181779..182564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0167"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bsu:BSU32000 2,3-dihydroxybenzoate-2,3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73019"
FT                   /db_xref="GOA:A0A0F6BHW8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR003560"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHW8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADP73019.1"
FT                   /translation="MEHWGLQGKIALVTGAAQGIGEAVTRSFVKHGVSVAAVDRNGERL
FT                   AALVSDLQSNGYDVQAFCADVANSAEIDEIVAQIEDNMGPIEILVNVAGILRTGLIESF
FT                   MDEDWEEVFKVNTAGVFYVSRSVSRRMIPRRSGAIVTVSSNAATIPRMFMAAYAASKAA
FT                   ATMFTKCLGLELARYHIRCNVVSPGSTETEMQRGLWTDENGANKVITGSMEEFRLGIPL
FT                   QKLAQPSDIADAVLFLVSEQSRHITMHDLRVDGGATLDA"
     atggaacatt ggggacttca gggaaaaata gcccttgtca caggtgccgc ccaaggaatc        60
     ggtgaagcgg tgacaaggtc tttcgttaaa catggcgtgt ctgttgcagc ggttgatcga       120
     aatggcgagc gattggctgc tctcgtctct gatttacaga gcaatggtta cgatgtgcag       180
     gctttttgtg cagatgttgc caatagtgca gaaattgatg aaatcgttgc tcaaattgag       240
     gacaacatgg gtcctattga aattttggtt aatgttgctg ggattctccg aacaggtctc       300
     atcgaaagtt ttatggatga agactgggaa gaggtattca aagtgaacac ggccggtgtt       360
     ttttatgttt cccgttcggt cagcaggcgg atgattccgc gccgttcagg tgcgatcgtc       420
     acagttagct cgaatgccgc cactatccca agaatgttta tggctgctta tgctgcttca       480
     aaggcagcgg caaccatgtt tacgaaatgt cttggccttg agcttgctcg gtatcatatt       540
     cgctgcaacg ttgtctctcc gggttccact gaaacggaaa tgcagcgggg actgtggacg       600
     gatgaaaatg gggcgaataa agtgatcact ggttcgatgg aggagtttcg tctcggtatt       660
     cctctgcaaa agctggctca gccttcagat atcgcagatg cggtgctatt tctcgtttct       720
     gagcagtcac gtcatatcac gatgcacgat ttaagggtag atggcggcgc aacgttagac       780
     gcataa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page