(data stored in SCRATCH zone)

EMBL: CP002293.PE164

CP002293.PE164       Location/Qualifiers
FT   CDS_pept        182588..183826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0168"
FT                   /product="isochorismate synthase"
FT                   /note="KEGG: bsu:BSU31990 isochorismate synthase DhbC;
FT                   TIGRFAM: isochorismate synthase; PFAM: Chorismate
FT                   binding-like"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73020"
FT                   /db_xref="GOA:A0A0F6BHW9"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHW9"
FT                   /inference="protein motif:TFAM:TIGR00543"
FT                   /protein_id="ADP73020.1"
FT                   /translation="MKTKTIQHVTAEQLLAEYKEGTSFFLASPHRTLLAQGIFATVPTD
FT                   GYEHKRMQILDHVKKVLQDAKQQGINGNPIVVGAIPFDHMYPAQLIVPSEVKWSGPLPF
FT                   GQWNGQIGQNAANEYEVKPVPSPQEYENAVEQGLSRIKAGDLRKVVLSRSLHLASSEKI
FT                   DVPHLLRKLAVHNPNGYTFAAALPERLDREAGKASGTKKNRTLLGASPELLVSKSGLRV
FT                   IANPLAGSAPRSEDPEEDQRRANALFSSAKDRHEHAVVIEAVANALRPFCKTLSVPEEP
FT                   SLIHTETMWHLSTVISGELSSPSITSLELALALHPTPAVCGTPTPLAKKAIQEIESFER
FT                   GFFTGMVGWCDNEGDGEWIVAIRCAEVEDYSLRLFAGAGVVEGSTPKGELAETSAKFRT
FT                   MLQAIGLNNDILK"
     atgaaaacaa aaacaatcca gcatgttaca gctgagcagc ttcttgctga atataaagag        60
     ggaacatcct ttttcttggc ctcgccacat agaactcttt tagctcaagg aatttttgca       120
     acagtgccga ctgacggcta tgagcacaag cggatgcaaa tactcgatca tgttaaaaag       180
     gtcttacaag atgcgaaaca gcaaggaatt aacggcaatc cgattgttgt tggcgccata       240
     ccatttgacc atatgtatcc agcccagctt attgtgcctt cagaggtgaa atggtcgggc       300
     ccgctgccat tcggccaatg gaatggacaa atcggacaaa atgcggccaa tgagtatgaa       360
     gtgaaacctg ttccgtcgcc gcaggaatat gaaaatgccg tggaacaagg attgagcaga       420
     ataaaagcgg gcgatctgcg gaaagtcgtt ttatcaagat ctcttcatct tgcttcatca       480
     gaaaagatag atgttcctca ccttcttcgc aaattggcgg tacataatcc gaatggctat       540
     acatttgctg cagcgttgcc ggagcgtctg gatcgtgaag cgggcaaagc ttcaggcaca       600
     aagaaaaaca gaaccttgct gggagcaagc ccagagctgc tcgtttcgaa atcagggctg       660
     cgagtaatag cgaatccgct tgcaggctcg gcgccccgca gcgaagatcc cgaagaggat       720
     cagcgccgcg cgaacgccct tttttcttca gcgaaagatc gccatgagca cgccgtggtc       780
     atcgaagcag tagcaaatgc gctcagaccg ttttgcaaaa cattgagtgt tcctgaagag       840
     ccttcgctca ttcatacgga aacgatgtgg catctgtcaa cagtaataag cggagagcta       900
     tcttccccgt ctattacttc gctggagctg gcgcttgctc ttcatccaac tccagcggtt       960
     tgcggaacgc caacgccatt ggcgaaaaaa gcgatacaag aaattgaatc atttgaacgc      1020
     ggctttttta cgggaatggt tggctggtgc gacaatgaag gggatggaga atggattgtt      1080
     gcgatccgtt gtgccgaagt ggaagactat tctcttcgcc tttttgcagg agctggcgtt      1140
     gttgaagggt caacgccaaa aggagaactg gcggaaacat cagctaagtt tcgcacgatg      1200
     cttcaagcta tagggttaaa caacgacatc cttaaataa                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page