(data stored in ACNUC7421 zone)

EMBL: CP002293.PE165

CP002293.PE165       Location/Qualifiers
FT   CDS_pept        183843..185468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0169"
FT                   /product="2,3-dihydroxybenzoate-AMP ligase"
FT                   /note="KEGG: bsu:BSU31980 2,3-dihydroxybenzoate-AMP ligase;
FT                   TIGRFAM: 2,3-dihydroxybenzoate-AMP ligase; PFAM:
FT                   AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73021"
FT                   /db_xref="GOA:A0A0F6BHX0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011963"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX0"
FT                   /inference="protein motif:TFAM:TIGR02275"
FT                   /protein_id="ADP73021.1"
FT                   /translation="MLSGCPTWPKEFADFYRKEGCWAGETFGDMLRERALKYGDRIAVT
FT                   SGERQISYKELDRRADQLASGFRQLGIRPADRVVVQLPNRIEFFEVCFALFRLGALPVF
FT                   ALPSHRYSEISYFCEFSEAAAYIIPDQHGGFDFRSLAKQVKAAVPTLKHVIVVGEAGEF
FT                   EPLENLFIDPVQLPLVHSSDVAFFLLSGGSTGLPKMIPRTHDDYIYSLRVSAEICKLHQ
FT                   DSVYLAVLPIAHNYPLSSPGVLGTLYAGGKVVLADSPSPDEAFPLIQQEKVTITALVPP
FT                   LVWIWLDAASSCKYDLSSLQVLQVGGAKFSAEVAKRVKPVLGCTLQQVYGMAEGLVNYT
FT                   RLDDPEELIINTQGKPMSYYDEIRIVDEEDNEVEPGQVGELLTRGPYTIRGYYKAEAHN
FT                   AKAFTADGFYRTGDLVRMTPSGYLVVEGRVKDQINRGGEKIAAEEVENHLLAHPSVRDA
FT                   AVVAMPDEFLGERSCAFIILRDHSVKAAELKAFLQERGVASFKIPDRIEFVDSFPKTAV
FT                   GKINKRALRQIIAEKRQSAGKTNV"
     atgctaagcg gatgcccaac atggccaaag gagtttgcag acttttaccg gaaggagggc        60
     tgctgggcag gtgagacttt tggtgacatg ctgcgggaaa gggcgttaaa gtacggtgat       120
     cgcattgcag ttacttctgg agaaaggcaa atcagctata aagaactgga tagaagagcg       180
     gatcagcttg cctcaggatt ccgtcaactg gggattcgac cagcggatcg cgttgtcgtt       240
     caattgccga atcgaattga attttttgaa gtatgctttg ctttattccg tctgggggcg       300
     ctgcctgtct ttgccttgcc ttcacatcga tatagtgaaa tcagttattt ttgtgaattt       360
     agcgaagcgg cggcttatat tattccagac cagcatgggg gatttgattt ccgctccctt       420
     gccaagcagg tgaaggctgc tgttccaacc ctaaaacacg tcattgtggt tggagaggca       480
     ggagagtttg aaccattaga aaatctgttt atcgatcctg tccagctgcc gctggttcat       540
     tcaagcgatg ttgctttctt cctgctgtcc ggaggaagca cagggctgcc aaaaatgatt       600
     ccgcggaccc acgatgatta tatttacagt ctccgggtta gtgccgagat ttgtaagctt       660
     catcaagata gtgtttatct tgcggttctt cccattgccc ataattatcc gcttagttca       720
     ccgggtgtgc taggaacgtt gtatgccggc ggaaaagtgg tccttgcaga cagcccaagt       780
     cctgatgagg catttccgct tattcagcaa gagaaagtca ccattactgc gctcgtgccg       840
     ccgcttgttt ggatatggtt agatgccgca tcttcttgca agtatgattt atccagcctt       900
     caagttttgc aagtcggcgg ggcgaaattc agcgcagaag tagccaaaag agtaaaacca       960
     gttcttggct gcaccttgca gcaggtgtat ggcatggctg aagggctggt caactatacg      1020
     agattggatg atcctgaaga attgattata aatactcaag gaaagccaat gtcttactat      1080
     gatgaaatcc gcatagtaga tgaagaagat aacgaggtgg agcctggcca agttggagag      1140
     ctgttaacga ggggccctta taccattcgc ggatattata aagcggaagc gcataatgcg      1200
     aaagccttta ctgcggacgg cttttaccgg acgggcgact tggtgcggat gactccatcc      1260
     ggctacttgg ttgtcgaagg gcgcgtgaaa gatcaaatta accggggcgg tgaaaaaatt      1320
     gcggcggagg aagtggaaaa tcacctttta gcacatcctt ccgtacgtga tgcggctgtc      1380
     gttgcgatgc cggatgaatt ccttggcgaa cgatcgtgcg cttttatcat tctgcgtgat      1440
     cactctgtga aagcagctga actgaaggcg tttttgcaag agcgcggagt ggcaagtttt      1500
     aaaatacctg atcgcatcga attcgttgat tcatttccga agacagcggt tggaaaaatt      1560
     aacaagaggg cattacggca aatcattgcc gaaaaacggc aatctgcagg aaaaacaaac      1620
     gtataa                                                                 1626
//

If you have problems or comments...

PBIL Back to PBIL home page