(data stored in SCRATCH zone)

EMBL: CP002293.PE169

CP002293.PE169       Location/Qualifiers
FT   CDS_pept        194235..195026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0173"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   bwe:BcerKBAB4_2182 4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73025"
FT                   /db_xref="GOA:A0A0F6BHX4"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX4"
FT                   /inference="protein motif:PFAM:PF01648"
FT                   /protein_id="ADP73025.1"
FT                   /translation="MTEWQVVNSIPPLSDHTCQVWLSKTTDMQPWHVRMLNDEERKRAQ
FT                   SFRKDQDRARFIVGCALSRLVLATQLNMAPHQVPIDRTCPICHEAHGRPRLPYGFLQWS
FT                   VSHSGNIILVAFTTDAPVGVDVEWMNTAWDFDVVKMADGILTEKEIAHILQMPANDRMR
FT                   GFFIYWTRKEAVLKATGEGLNIPPLNVVVSGPQQAPRLLAFTGRPDGTDDVALHDLDLG
FT                   FNYVAALSIFSKTQKRIEQYDASVLMQQGFGWKDYYISQKS"
     atgacggagt ggcaggttgt aaattcgatc ccgcccctgt cggatcatac gtgccaagtt        60
     tggctatcga aaacaactga tatgcaacca tggcatgtcc ggatgctgaa tgatgaagaa       120
     aggaaaagag cgcaatcttt ccgcaaggat caagacagag cgcggttcat tgtcggttgt       180
     gcattaagtc gattagtatt ggcaacccaa ttgaatatgg ccccgcatca agtgcccatt       240
     gaccgcactt gtcccatttg ccatgaagcc catggccggc cgcgattgcc ttatggtttt       300
     ctgcaatggt ctgtttcgca ttctggcaat attattcttg ttgcctttac cacggatgcg       360
     ccagttggcg tcgacgttga atggatgaat accgcttggg atttcgatgt cgtcaaaatg       420
     gcagacggga tactcacgga gaaggaaata gcacatatat tgcaaatgcc ggcaaatgac       480
     cggatgaggg gttttttcat ctactggaca agaaaggaag cggttcttaa agcgacagga       540
     gaaggattga acattcctcc attgaatgtg gtagtctctg ggccgcaaca agccccgcgg       600
     ctgcttgctt tcaccggccg cccggatggt acagatgacg tggccctgca tgatttggat       660
     ttaggtttca actatgtagc tgcgctttct attttcagca aaacgcaaaa aagaattgag       720
     caatatgatg caagtgtgct tatgcagcaa ggtttcggct ggaaagatta ttatatttca       780
     caaaagtctt aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page