(data stored in ACNUC7421 zone)

EMBL: CP002293.PE173

CP002293.PE173       Location/Qualifiers
FT   CDS_pept        198041..199048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0177"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bcy:Bcer98_2408 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73029"
FT                   /db_xref="GOA:A0A0F6BHX8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX8"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADP73029.1"
FT                   /translation="MRSKIVSPAFILWLSPIVVVFTIMASILYGAKNIDWETVWNAIFH
FT                   FDPGNVNHQIVMHSRLPRVIGALLIGAFLAMSGAIMQGMTRNYLASPSIMGVSDGSVFA
FT                   ITLCMILAPGASSLDMIMYSLIGSLFAVGIVFGLASLLPNGMSPVRMAIIGTIIGTFLS
FT                   SVSAAMASYFQVSQNVSFWYNARLHQMDPDMIKLAVPFALVGIALALFISKSITILSLG
FT                   EEVSVSLGQRTTLVKAMAVASVVILTGISVALAGNIGFVGLIIPHITRFLVGVDYRWII
FT                   PCAGVLGAIFLALSDIFSRFLNYPFETPIGVVTSLIGVPFFLYLIYKRGGGKHA"
     atgcgttcaa agattgtttc gccagctttc atactttggc tctccccgat tgtagtggtg        60
     tttaccatca tggcatctat tctatatgga gcgaaaaata tcgattggga gacggtttgg       120
     aatgcgattt tccattttga tccgggcaat gtgaaccatc aaattgtgat gcattcccgg       180
     ctgccaaggg tgatcggagc gcttcttatc ggagcgttcc tagccatgtc aggggccatc       240
     atgcaaggaa tgacaagaaa ctatcttgcg tccccttcta ttatgggggt ttctgacggc       300
     tcggtttttg ccattacact ttgtatgatt ttggcgccgg gagcctcttc tttggatatg       360
     attatgtatt cactgattgg ctcgctgttc gctgtgggca tcgtcttcgg gctcgcgtca       420
     ctcttgccga atggaatgtc tccggtccga atggcgatca tcggcactat tatcggcaca       480
     tttctgagca gcgtctcagc cgccatggct tcctattttc aagtttcaca aaacgtcagt       540
     ttttggtaca atgcccggct gcaccagatg gatcccgata tgatcaaact tgcggtgcct       600
     tttgcgctgg tcggaatcgc gctcgcgctc tttatttcca aatcgatcac gattctctca       660
     ttgggcgagg aagtgtccgt gagcttgggg cagagaacga cgctggttaa ggcaatggct       720
     gtcgccagcg tcgtcatttt aaccggcatt tccgtcgctt tggctggtaa tatcggattc       780
     gtgggcctga ttattcctca tatcacccgg tttttagttg gggttgatta tcggtggatt       840
     attccttgcg ccggcgtcct cggagccatt tttttggcac tttccgatat cttcagcagg       900
     ttcttgaact atccgtttga gacgccgatc ggggtcgtca cttccttgat aggagtgcct       960
     ttcttcctct atttaattta caagagagga ggagggaaac atgcttaa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page