(data stored in SCRATCH zone)

EMBL: CP002293.PE175

CP002293.PE175       Location/Qualifiers
FT   CDS_pept        200106..200672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0179"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: bbe:BBR47_03460
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73031"
FT                   /db_xref="GOA:A0A0F6BHY0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY0"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADP73031.1"
FT                   /translation="MELSQLLRERRSIHVFEDRPVSPELVMELLDTAVWVPNHRMTQPW
FT                   RFILTYGEGRRKIAEAVRKIKESKEPDPSKKKEVGQKFYNKIMSIPMILTVLMREDPNL
FT                   IVREEDYASTSCVIHNFSLLAWEKGIGMVWETYGWLHEPIFRETMGIQPVEKVVGNLHI
FT                   GYPAKIPSAQPRIPAAHLITVFDQA"
     atggaactta gccaattgtt gagagaacgc cgctcgattc atgttttcga ggatcgcccc        60
     gtatctcccg aacttgtgat ggaactgctg gacaccgccg tttgggtgcc caatcaccgt       120
     atgacgcagc cgtggcgttt tattctcact tatggtgaag gacgcaggaa gatcgctgaa       180
     gcggtgcgga aaatcaaaga gagcaaagaa ccagatccaa gcaaaaagaa agaagttgga       240
     caaaaatttt acaataaaat catgtccatt ccgatgattt taactgtcct gatgagggaa       300
     gatccgaatc tgattgtcag ggaagaagat tatgcgtcga ctagttgcgt tatccacaac       360
     tttagtttat tggcatggga gaagggaatc ggaatggtgt gggaaacata cggatggcta       420
     catgaaccca tcttccggga aacaatggga atccagcctg tggaaaaggt ggtaggcaat       480
     cttcatatcg gatatcctgc gaaaattcca tctgcacaac caagaattcc tgccgctcat       540
     ttgatcactg tctttgatca agcctga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page