(data stored in ACNUC7421 zone)

EMBL: CP002293.PE178

CP002293.PE178       Location/Qualifiers
FT   CDS_pept        complement(202781..203782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0182"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bwe:BcerKBAB4_0329 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73034"
FT                   /db_xref="GOA:A0A0F6BHY3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY3"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADP73034.1"
FT                   /translation="MIQSALIKKQRRILVILLILIMATIVIGMGTGYSSLSYDRLIPVL
FT                   FGQGTFKEEFILFSIRLPRIVITLLAGMALALSGAILQGITRNDLADPGILGINSGAGV
FT                   GVAVFFLFFPIQSNSFAYLIPLIAFISALLTACFIYLLSYNRNAGFQPVRLVLIGVGFS
FT                   MALSGAMIVLISSAERTKVDFIAKWLAGNIWGDDWPFILAILPWLIVLIPLTLYKANRL
FT                   NILELNEPMAIGVGLEIQKERILLMITAVALAAAAVSVTGGIAFIGLMAPHIAKALIGP
FT                   RNQLFIPIAILMGGWLLLFADTIGRNIADGIPTGIIVSLIGAPYFIYLLLRK"
     atgattcaat cagcgttaat caaaaaacaa cggcggattc tcgttatttt actgatattg        60
     atcatggcaa caatcgtgat cgggatggga acaggttatt cctccctatc ttatgaccgg       120
     ctgattcccg tccttttcgg ccaaggcacg tttaaagaag aatttatttt attttccatc       180
     cgcctgccgc ggattgtgat cacactgctg gccgggatgg ccctcgcgtt gtcgggcgct       240
     atcttgcaag gaatcactcg gaacgattta gcggatcccg gcattttagg cattaattct       300
     ggcgccggcg ttggagtggc ggtgttcttt ttgtttttcc ctatacagtc gaattccttt       360
     gcttacttga ttccgcttat cgcctttatt agcgctttac tgacggcgtg tttcatttat       420
     ttgctatcat ataaccgaaa cgcagggttt cagccagtaa ggttggtgct tatcggagtc       480
     ggattttcca tggcgctttc tggggccatg attgtgctca tttcctctgc cgaacggaca       540
     aaagtagatt ttatcgccaa atggctggcc ggaaatatat ggggtgatga ttggccgttt       600
     atattagcca ttcttccatg gttaattgtc ctgataccat tgacattata caaagcaaac       660
     cggttgaata tattagaatt aaatgaaccg atggcaatcg gagtcggatt agaaattcaa       720
     aaagagcgca ttttattgat gatcactgct gttgcgctag ccgctgccgc cgtttccgtc       780
     accggaggaa ttgcctttat cggcctcatg gctccgcata tcgcaaaagc attaataggg       840
     ccgagaaacc aactatttat cccgatcgca attctgatgg gcggatggct tttattattc       900
     gctgacacca tcgggcgcaa tatagcagac ggtattccaa caggcatcat cgtttcttta       960
     atcggcgcgc catattttat ttatttatta ctgagaaaat aa                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page