(data stored in ACNUC7421 zone)

EMBL: CP002293.PE18

CP002293.PE18        Location/Qualifiers
FT   CDS_pept        27234..28919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0018"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /note="TIGRFAM: DNA polymerase III, subunits gamma and tau;
FT                   PFAM: AAA ATPase central domain protein; KEGG:
FT                   gwc:GWCH70_0019 DNA polymerase III, subunits gamma and tau;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72874"
FT                   /db_xref="GOA:A0A0F6BHH3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH3"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ADP72874.1"
FT                   /translation="MTYQALYRVFRPQRFADVVGQEHVTKTLQSALLQNKISHAYLFSG
FT                   PRGTGKTSAAKIFAKAVNCEHAPTAEPCNECPACIGITNGTIPDVLEIDAASNNRVDEI
FT                   RDIRDKVKFAPTSVRYKVYIIDEVHMLSIGAFNALLKTLEEPPKHVIFILATTEPHKIP
FT                   LTIISRCQRFDFRRIPLHSIVARLRHVMEQQGMTASDEALFAIARAADGGMRDALSLLD
FT                   QAISFSDGELLLEDVLAMTGSVSSATLASLIQAVYEKDAATSLRLLEEMMDQGKDPNRL
FT                   MEDLILYYRDLLLYKTAPHVEGAIKGTIVDDTFQHLAESIPLSDIYEAIEVLNKSQQEM
FT                   KWTNHPRIFLEVALVKLCHQQASSTSSSAEEIQSLARKVEYLEAELRRLKEHNESVAAT
FT                   APAQAQKQTRPLKTGGYKTPVGRIHEILKQATHQDLSLIKSHWAEMLDTLKKQHKVSHA
FT                   ALLQESEPVAASPNAFVLKFKYEIHCKMAADNTNYVKDNLEAILFELTKKRFEMVAVPE
FT                   EEWGKIREEFIREKGTKREQEKEEDPLIAEAKRLFGEEIIEIKE"
     gtgacatacc aagctttata tcgtgttttt cggccgcagc ggtttgcgga cgttgtcggc        60
     caggaacacg tgacgaaaac attgcaaagt gccctgcttc aaaataaaat atctcacgct       120
     tatttgtttt cgggtccgcg cggcacagga aaaacgagcg ctgcgaaaat tttcgcaaaa       180
     gcggtaaatt gcgagcatgc accgacggca gaaccgtgca atgaatgtcc tgcgtgcatc       240
     gggattacaa atggcactat tccggacgta ttggaaattg acgcggcttc gaacaaccgg       300
     gtcgatgaaa ttcgcgatat ccgcgataaa gtgaaatttg cgccaacatc tgttcgctat       360
     aaagtatata ttattgatga agtgcatatg ctttcgattg gcgctttcaa cgcattgtta       420
     aagacgttag aggaaccccc gaagcacgtt atttttatat tggcaacaac agagccacat       480
     aaaatcccgc ttacgattat ttcccggtgt cagcgctttg attttcgacg gatcccattg       540
     cattccattg tcgcgagact gcggcacgtg atggaacagc aagggatgac agcttccgat       600
     gaagctttgt ttgcgattgc gcgcgcggcc gatggcggaa tgcgcgatgc gttaagcttg       660
     cttgatcaag ctatttcatt tagcgatgga gaattgctgc ttgaagacgt ccttgccatg       720
     acaggttccg tgtcttctgc gacattggcc tctcttattc aggctgtata tgaaaaagat       780
     gcggcaacat cgttgcgtct gcttgaggaa atgatggatc aaggaaaaga tcctaaccgc       840
     cttatggaag atttaatttt atattatcgc gatcttttgc tttataaaac ggctccccat       900
     gttgaaggag caatcaaagg caccattgtc gacgatacgt ttcaacattt ggcggaatcg       960
     attccgttat ctgacatata tgaagcgatt gaagtgttaa ataaaagcca gcaagaaatg      1020
     aaatggacga atcatccgcg cattttctta gaggtcgcgc tggtgaagct ttgccatcaa      1080
     caagcttcgt ccacatcttc gtctgctgaa gaaatccaat cgcttgcgag aaaagtggaa      1140
     tatttggaag cggagctgcg ccgtttgaaa gaacacaatg aatctgtggc ggcaaccgcc      1200
     cccgcgcagg cgcaaaaaca aacgaggccg ctgaaaacgg gaggatataa aacgccggtt      1260
     ggccgtattc atgaaatatt aaagcaagcg acccatcagg atttatcgct catcaaaagc      1320
     cattgggctg agatgctcga tacattaaag aaacagcata aagtgtccca tgcggcttta      1380
     ttgcaggaaa gcgagccagt tgcggcaagc ccgaacgctt ttgtgttgaa gtttaaatat      1440
     gaaattcact gcaaaatggc tgctgacaat acgaattatg tgaaagataa tttagaggcg      1500
     attttattcg aactgacgaa aaaacgtttt gagatggtgg ccgttcctga agaagaatgg      1560
     ggaaagataa gggaagaatt catccgcgaa aaagggacga agcgcgaaca agaaaaagaa      1620
     gaagatccgt taatcgcaga agcaaaacgg ctgtttggcg aggaaatcat tgaaattaag      1680
     gaataa                                                                 1686
//

If you have problems or comments...

PBIL Back to PBIL home page