(data stored in ACNUC7421 zone)

EMBL: CP002293.PE180

CP002293.PE180       Location/Qualifiers
FT   CDS_pept        complement(204870..205793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0184"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73036"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY5"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADP73036.1"
FT                   /translation="MKKLLIPFIVLIVLVMSACGGKTTENKDNSAAKEKEPETITYQSE
FT                   NGPIEVPAHPKRVVVLSSFAGHVMALGVNIVGVDQWSKMNPRFQDKLKNAEVVTDEDIE
FT                   KIIELNPDLIIGLSNTKNVDKLSKIAPTVTYTYGKVDYLTQFLEIGKLLNKEKEAKAWI
FT                   DDFKKRAQQAGEEIRAKIGENATVSVIENFDKQLYVFGNNWGRGTEILYQEMKLKMPKK
FT                   VEEMALKQGYYALSLEALPQFAGDYLIISKNPDGDTSFQQTETYKNLPAVKNHRVFEAN
FT                   AKEFYFNDPITLEYQLDFFKKHFLGE"
     atgaaaaaac tgttgatccc cttcatcgtg ctgattgtac tagtaatgag cgcttgcggc        60
     ggcaagacaa ctgaaaataa agacaattcc gccgcaaaag aaaaggaacc agaaacgatt       120
     acgtatcaat ccgaaaacgg gccaatcgag gttcctgccc atccgaaacg tgtggttgtg       180
     ctgtcctctt tcgccggcca tgtgatggcc ttaggcgtca atatcgttgg tgtcgatcaa       240
     tggtcgaaaa tgaaccctcg ctttcaagac aagctgaaaa atgctgaggt agtgactgac       300
     gaagatatcg aaaaaatcat agaattaaat ccagatttga ttattgggtt gtctaacaca       360
     aagaacgtcg ataaattaag caaaattgct ccaactgtca catatacgta cggaaaagtt       420
     gactacttaa cacaattttt agaaatcggc aaactgttaa ataaagaaaa agaggcgaaa       480
     gcgtggatcg atgactttaa aaaacgggcg caacaagccg gagaagaaat aagagcgaaa       540
     attggcgaaa atgccactgt ttctgtcatc gaaaacttcg ataaacaact ttatgttttt       600
     ggaaataact ggggaagagg tactgaaatt ctttatcaag aaatgaagtt aaaaatgcct       660
     aaaaaagtgg aagaaatggc attaaaacaa ggttattatg cactgtcatt agaagcgctg       720
     cctcagttcg ccggcgacta tttaatcatt agcaaaaatc cagatggcga cacttcattc       780
     cagcaaacgg aaacatacaa aaaccttccg gcagtaaaaa accaccgggt gtttgaggca       840
     aatgcgaaag agttctattt taatgacccg atcacactag agtaccagct cgatttcttt       900
     aaaaaacatt ttttaggtga gtaa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page