(data stored in ACNUC7421 zone)

EMBL: CP002293.PE182

CP002293.PE182       Location/Qualifiers
FT   CDS_pept        206772..207821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0186"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: afl:Aflv_0174 thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73038"
FT                   /db_xref="GOA:A0A0F6BHY7"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY7"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADP73038.1"
FT                   /translation="MEREELYDVTIIGGGPAGLYAAFYSGLRKMKTKLIECQPQLGGKL
FT                   HVYPEKIIWDVGGHAPITGEQLMKQLVKQGLTFHPTVILNEKVVSMKRQNDGIFVLSTA
FT                   SGQQHFSKTVIVAVGSGILKPKKLEIEGAEKFEVTNLHYTVKSLKRFKDKTVIISGGGN
FT                   SAIDWANELVPIAKKVYLTYRNEELKGHESQVTQLLNSSAVCYFNTSITKLIASANHEI
FT                   IDRVELTNHETGEVIYLPVDEVIVNHGYERDTSLLENSELDIKMVDNDYIAGNANCESS
FT                   VPGLYAAGDILKYDGKLNLIIGAFQDAANAVNSAKRFIEPAADPFGMVSSHNEIFKKQN
FT                   QEFIKQMMK"
     atggaacggg aagaactgta tgatgtgacg attattggcg gagggccagc agggctttac        60
     gctgctttct acagcgggct gcggaagatg aagacaaagc tgattgaatg tcagccgcag       120
     ttaggtggga aactgcatgt ctatcctgag aaaataattt gggatgtggg agggcatgcg       180
     cccataacag gagaacagtt aatgaaacaa ttagtaaaac aagggttaac gtttcatcct       240
     acggtcatat taaatgaaaa ggtagtgtcc atgaagcgtc agaatgatgg catttttgtg       300
     ttatcgacgg cttccggaca gcagcatttt tcaaagacag taattgtggc ggtaggaagt       360
     ggcatcttaa agccgaaaaa actggagata gaaggggcag aaaaatttga ggtaacgaat       420
     ttacattata cggtgaaatc attaaagcgc tttaaagata aaaccgtgat catttctggc       480
     ggcggcaact ctgctatcga ttgggcgaat gaattagtgc cgattgccaa aaaagtgtac       540
     ttaacctatc gaaatgaaga gttaaaaggt catgaatcac aagtaacgca gttattgaat       600
     agttcagccg tttgttattt taatacgtcg attaccaaat taatcgccag tgcgaatcat       660
     gaaatcattg accgtgtcga gctgacaaac catgaaacgg gagaagttat ctatttgccg       720
     gtggatgaag tgattgttaa tcacggttat gaacgtgata catcattact tgaaaatagt       780
     gagttagata taaaaatggt cgataatgat tatattgcag gcaatgcgaa ttgtgagtcc       840
     tccgtacccg ggctttatgc ggctggtgat attttaaaat atgacggaaa gttaaattta       900
     atcatcggtg cttttcaaga cgcagcaaat gcggtcaaca gcgctaaacg gtttattgag       960
     cctgcggctg atccatttgg aatggtttct tcgcataacg aaatctttaa aaaacaaaat      1020
     caggagttca ttaaacaaat gatgaaataa                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page