(data stored in ACNUC7421 zone)

EMBL: CP002293.PE183

CP002293.PE183       Location/Qualifiers
FT   CDS_pept        208627..209481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0187"
FT                   /product="rRNA (adenine-N(6)-)-methyltransferase"
FT                   /note="PFAM: ribosomal RNA adenine methylase transferase;
FT                   KEGG: bha:BH0380 rRNA adenine N-6-methyltransferase; SMART:
FT                   Ribosomal RNA adenine methylase transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73039"
FT                   /db_xref="GOA:A0A0F6BHY8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY8"
FT                   /inference="protein motif:PRIAM:2.1.1.48"
FT                   /protein_id="ADP73039.1"
FT                   /translation="MKKQNKRNHRTRKYIEWPNFSGQHLLHNKRIINDLIQIANLTSND
FT                   TVLDLGAGKGALTFPVAEKAGKVIAVEYDPRFVEILKKKAEAYPNIKVIQQDILKLRLP
FT                   KEPFIVVAGIPYAITTPIMKMLLHQPANSLQRAVLVMEKGAAKRFTSYPITNPLILKWR
FT                   MWFDLGYVREISRENFSPPPKVDSAILIIRRKKKLSIPYKYYDSFLGLAEYALKYPQLP
FT                   LYEALKGVFTPPQITRLVRNLGVNRNIAICLLNEIQWGIVFHTMVQYVQRPYWPKAKKH
FT                   KNN"
     atgaaaaaac aaaataaacg caatcacaga acccgcaaat atatagagtg gcctaatttt        60
     tctggtcaac atcttttgca taacaagcgg atcattaatg acttaattca aatagcaaat       120
     ttgacttcta atgacaccgt attggatctt ggagcgggaa aaggagcact gacgtttccg       180
     gtggcagaaa aagcaggaaa ggttatcgct gtagagtatg accctcgctt tgtagagatt       240
     cttaagaaaa aagcggaagc ttatcctaat attaaagtta ttcaacaaga tattttaaag       300
     cttcgtcttc ctaaagaacc ttttattgtc gtagctggca tcccatatgc tattacgacg       360
     ccaattatga aaatgcttct tcatcaacct gctaattcat tacaaagagc cgtgttagtg       420
     atggaaaaag gagcagctaa gcgtttcact tcttatccca ttacgaatcc gcttatttta       480
     aagtggcgaa tgtggtttga tttaggatat gtaagagaaa tttctcgtga aaacttttcc       540
     cctccaccaa aggtagattc cgccatctta atcatacgga ggaaaaagaa acttagcatt       600
     ccatacaaat attatgacag ttttttaggg ttggctgaat atgctttgaa atatccgcaa       660
     ctgccattgt acgaagcatt gaaaggagtg tttactcctc cgcaaataac ccgtttggtt       720
     cgaaatctcg gcgtcaaccg aaatatagcc atttgtttgc tgaatgaaat tcagtggggg       780
     attgttttcc atacgatggt ccagtatgtt caacgtccgt actggccaaa agccaaaaag       840
     cacaaaaata actaa                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page