(data stored in ACNUC7421 zone)

EMBL: CP002293.PE184

CP002293.PE184       Location/Qualifiers
FT   CDS_pept        209510..210385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0188"
FT                   /product="rRNA (guanine-N(1)-)-methyltransferase"
FT                   /note="KEGG: pjd:Pjdr2_1632 hypothetical protein; PFAM:
FT                   Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73040"
FT                   /db_xref="GOA:A0A0F6BHY9"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY9"
FT                   /inference="protein motif:PRIAM:2.1.1.51"
FT                   /protein_id="ADP73040.1"
FT                   /translation="MSKKIICAKLINKFEKIFQCPICSSPMGIVDLKSLICSNNHTFDI
FT                   AKQGYVNLMTRSLATRYDKELFESRKIIAESGFFEPLYRMVSEWIKNDVRLEEETVKIL
FT                   DTGCGEGSHLSRIKQKISSHSTGEVLGVGIDIAKEGILVAAKHHSNMIWCVADLAHSPF
FT                   KSNTFDVILNILSPANYKEFQRLLNDNGIVIKVVPRSDYLKELREVFFDEPEKQSYSNQ
FT                   KIVRRFNANFETVDMFRLCYSISLSKALIPPLIHMTPLSWSATAEKIEALLNMNLSEIT
FT                   IDLDVLIGKK"
     atgagcaaaa aaatcatatg cgccaaactg atcaataaat ttgaaaagat tttccaatgt        60
     ccaatttgtt cgtctcctat gggaatcgtg gacttgaaaa gtttaatttg ctctaacaac       120
     catacttttg atatcgccaa gcagggatat gtaaatttga tgactcgttc tctcgcaacg       180
     aggtacgata aagaattatt tgaatcacgt aagattattg ctgaaagtgg attttttgaa       240
     ccgttataca ggatggttag tgaatggata aaaaatgacg tgcgtttaga ggaagaaacg       300
     gtaaaaatac tagacacagg atgcggagag ggatcgcatt tatccaggat caagcagaaa       360
     atcagttctc attccaccgg tgaagtattg ggagtgggga ttgatatagc gaaagagggt       420
     attttggtag cagctaagca tcattcaaac atgatttggt gcgtcgctga tcttgcacac       480
     agccctttta agagcaacac atttgacgta atccttaaca tcctgtcgcc agcaaactat       540
     aaagaattcc aaagactgct gaatgacaac ggcatcgtca taaaagtggt tcctcgaagt       600
     gattatctga aagaactaag agaagttttc tttgatgaac cagaaaagca gtcttattct       660
     aatcaaaaga tagttcgaag atttaatgct aactttgaaa ctgtggacat gtttcggttg       720
     tgttacagta tttctttgag taaagcgctg attccaccgt tgattcacat gactccttta       780
     tcatggtctg caacagcgga aaagatagag gcattgttaa acatgaattt atccgaaata       840
     accatcgatc tagatgtttt aattggaaaa aaataa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page