(data stored in SCRATCH zone)

EMBL: CP002293.PE186

CP002293.PE186       Location/Qualifiers
FT   CDS_pept        211607..212812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0190"
FT                   /product="Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; KEGG:
FT                   bcm:Bcenmc03_6803 cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73042"
FT                   /db_xref="GOA:A0A0F6BHZ1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ1"
FT                   /inference="protein motif:PFAM:PF01053"
FT                   /protein_id="ADP73042.1"
FT                   /translation="MDKRDHREEMNLEGLRTETLVIHGDDWVIDDRTVAPAIYYTATFR
FT                   AHNSREFAEMAGTPRHPRYYTRYGNPVHERVAKIMAELEGTETALVTGSGMGAIATTIL
FT                   TLVSAGDHVIAQTRHYMSTAKIMDEMLPRFGVEVTLVEQADINAFAEAIRPNTKLIMVE
FT                   TPANPTLVLTDLAAVVELARPRGIIVVADNTFASPINQRPHDLGVDVVIHSATKYLGGH
FT                   HDLTAGVICTSKELAERIWQTHISIGSVLSPMDAWLLLRGLRTLPIRMERINANALALA
FT                   EFLEEQPQVERVYYPGLPSHPQHELAKRQMRGFGAVIAFAIKGGYEETQRFVSALKLPP
FT                   NAVSLGGVDSLVVHTAAMWEGVMTEEQMKTAGIPANFVRFSVGLEHIDDLKADVWQALQ
FT                   VV"
     atggataaac gtgatcatcg tgaagagatg aatcttgaag ggttacggac ggaaacgttg        60
     gttatacatg gcgatgattg ggtcatcgat gacagaacgg tggctccggc aatttattac       120
     acagctacgt ttcgtgccca taattcccgc gaatttgcgg aaatggcggg aacgccccgg       180
     catccccggt attacacgcg ttacggcaat ccagtgcatg agcgcgtagc gaagattatg       240
     gcggagctgg aaggcacgga aaccgcgctt gtcactggtt ccgggatggg ggcaatcgct       300
     acgaccattt tgactctggt cagtgcggga gatcatgtga tcgcacagac gcggcattat       360
     atgagcaccg ccaagatcat ggatgagatg ttgccacgat ttggagtgga agtgacgctg       420
     gtcgagcaag cggacattaa cgcttttgcg gaagcgatac ggccgaacac aaagctcatc       480
     atggtggaga cgccagctaa tccgacttta gtattgacgg atttggctgc ggtggtggag       540
     ctggcgcgtc cgcgagggat tatcgtcgtg gccgataaca catttgcgtc gccgatcaat       600
     cagcggcctc acgatttagg cgtcgatgtc gttattcaca gcgcaacaaa gtatttaggt       660
     gggcaccatg atttgacagc tggtgtcatc tgcacgagca aggagttggc ggagcgcatt       720
     tggcagacgc atatttccat cggctcggtc ctttcgccaa tggatgcatg gctgttattg       780
     cgcggtctgc gtacgcttcc gatacgaatg gaacgcatta acgctaacgc cttagccttg       840
     gctgagtttt tagaggaaca gccgcaggta gagcgggtgt attatcctgg tcttccgagc       900
     catccgcaac atgaattggc caaacggcag atgcgcgggt tcggggcggt cattgccttt       960
     gccattaaag gcggttatga agaaactcag cggtttgttt ccgcgttaaa actgccgcct      1020
     aacgcagtga gcctgggagg cgtcgattcc cttgtggtac atacagcagc gatgtgggaa      1080
     ggagtgatga ccgaggagca gatgaaaaca gctgggattc cggccaattt cgtgcgattc      1140
     tcggtcgggc tcgaacatat cgatgatctg aaagcagatg tgtggcaggc tttgcaggta      1200
     gtttaa                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page