(data stored in ACNUC7421 zone)

EMBL: CP002293.PE187

CP002293.PE187       Location/Qualifiers
FT   CDS_pept        212934..213383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0191"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73043"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ2"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1311"
FT                   /protein_id="ADP73043.1"
FT                   /translation="MKSSAANEVIALYQRLLDGWNDRNAAAMAEQFTEKGELIGFDGTQ
FT                   AIGREEIFAHLHPIFENHPTPPYVSKVKDVRFLASDIAILRAIAGMVPPGQSDVDPKLN
FT                   AHHTLVAVKNEECWRIELFQNTPVQFHGRPELAEQMTEELRQLLK"
     gtgaaatctt ctgcagcaaa tgaagtcatc gcgctctatc aacggctgtt agatggatgg        60
     aatgaccgca atgccgctgc aatggcggag caatttacag agaagggcga gctcatcggc       120
     tttgatggga cccaggcaat tggacgggag gagatctttg cccatcttca cccgatcttt       180
     gaaaatcatc ccactccccc atatgttagc aaagtgaaag atgtgcgttt tctcgcttct       240
     gacattgcca ttttacgcgc tatagcagga atggtgccgc ctggacagtc agatgtcgat       300
     ccgaagctca acgcgcatca cacgcttgtc gcagtcaaga acgaagagtg ctggcggatc       360
     gagctgtttc agaatacccc ggttcagttt cacggaagac ctgagttggc cgagcaaatg       420
     accgaggaat taaggcagtt gcttaagtaa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page