(data stored in SCRATCH zone)

EMBL: CP002293.PE190

CP002293.PE190       Location/Qualifiers
FT   CDS_pept        217065..217397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0194"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: gwc:GWCH70_0175 transcriptional regulator, PadR-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73046"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ5"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADP73046.1"
FT                   /translation="MSLRSQLLKGVLEGCILAIIKKESVYGYELSVKLQKFGLNDVSEG
FT                   SIYPLLLRLQKAGLIKGEMRDSPSGPKRKYYHLTEKGEEALQDFIAEWESIRKPVEKIL
FT                   RGGNME"
     atgtcgctca gaagccagct gttaaaagga gtgctggaag gatgcatttt ggccattatt        60
     aaaaaggaat ctgtgtacgg ttatgaactg tcggtaaagc tgcagaagtt tggccttaat       120
     gacgttagtg aaggctccat ttatccgctg ttgcttcggc tgcaaaaagc agggctgatt       180
     aagggggaaa tgcgcgattc cccctcagga ccgaagcgaa agtattacca tctgacagaa       240
     aaaggggagg aagcgctgca agacttcatc gctgaatggg agagcatccg caagccggtc       300
     gagaaaattt tgcgaggggg aaacatggaa tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page