(data stored in ACNUC7421 zone)

EMBL: CP002293.PE193

CP002293.PE193       Location/Qualifiers
FT   CDS_pept        219502..220827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0198"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73049"
FT                   /db_xref="GOA:A0A0F6BHZ8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ8"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADP73049.1"
FT                   /translation="MFEYSIVQLARHYAHKLDRPLRHFLVSIYKPFLYTPCIIHKQLER
FT                   WMKKMKRIPVIIQFHEENGVFALKEVEKQHFRMKIHHQFRYIPSCSAEVTPQALEQILQ
FT                   RHDVKKVYLNRKVSALLNNAVPSANAKNVAVNGTALSGKGVTIAIVDTGIYPHPDLEGR
FT                   IAGFVDFVNGRTEPYDDNGHGTHCAGDAAGNGSVSSGLYRGPAYEANVVGVKVLNKVGA
FT                   GRLDTIIRGIEWCIQYNETSKDEKIDIISLSLGGESQPFPEENDDPLVQAAEKAWDKGI
FT                   VVCAAAGNAGPEYRTISSPGISDKIITVGALDDRDTAETREDDEIANFSSRGPTYYGVS
FT                   KPDIVVPGVNIVSLRAPKSFLDKYQKQNRIGQYYMSMSGTSMATPICAGIVALMLQYKP
FT                   DATPDEIKRALKEGAGLWKDRDPNIYGAGYVDAQRAIGLLAK"
     atgtttgagt attccatcgt tcaactggcg cgtcattatg cacataaatt agaccgtcct        60
     ttgcgtcatt ttctggtaag catatataaa ccttttctgt atactccgtg tatcattcat       120
     aaacagctcg aaagatggat gaaaaagatg aaaagaattc cggtcatcat tcaatttcac       180
     gaagaaaatg gcgtttttgc ccttaaagaa gtggaaaaac aacatttccg catgaaaatt       240
     catcatcaat tccgctatat cccttcatgc agtgctgaag tgaccccgca agcattagag       300
     caaattttgc agcggcacga tgtgaaaaaa gtatacttaa accgaaaagt aagcgcgctg       360
     ttgaataacg ccgttccgtc cgctaacgcc aaaaacgtcg ctgtaaacgg cacggcatta       420
     agcggaaaag gagtgacgat tgcgattgtc gacacaggga tttatccgca tcctgattta       480
     gaggggcgga tcgccggatt tgtcgatttt gtcaacggac gtacggaacc atacgatgat       540
     aacgggcatg gcacccattg cgccggggac gccgccggaa acggctcggt ttcttccgga       600
     ttgtataggg ggcccgcata tgaagcaaat gtagtcggag taaaagtgct caataaggtg       660
     ggggcaggaa ggcttgatac gattattcgc ggtattgaat ggtgcataca atacaatgaa       720
     acgagcaaag acgaaaaaat cgatattatt tcattatcgt taggcggcga atcgcagcca       780
     tttccagaag agaatgacga tccgcttgtt caagcggcgg aaaaggcatg ggacaagggc       840
     attgtcgtct gtgcggcagc tggaaacgcg gggccggaat atcgaacgat ctcaagcccg       900
     gggattagcg ataaaatcat aacggttggc gctttggacg accgcgatac ggcagagaca       960
     agagaagatg atgaaattgc caatttttcg agccgcggcc ctacttacta tggagtgagc      1020
     aagccggata ttgtcgttcc aggggtcaat atcgtttcct tgcgtgcgcc aaagtctttc      1080
     ctcgataaat atcaaaaaca aaaccgcatc gggcaatatt atatgagcat gtcgggaaca      1140
     tcgatggcga cgccgatctg tgccggcatt gtcgcgctaa tgcttcaata taagccggat      1200
     gcgacgccag atgaaattaa aagggcatta aaagaaggag caggtttatg gaaagaccgg      1260
     gatccgaata tatacggggc gggatatgtc gatgcgcaaa gggcgattgg gctgttggcg      1320
     aaataa                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page