(data stored in ACNUC7421 zone)

EMBL: CP002293.PE194

CP002293.PE194       Location/Qualifiers
FT   CDS_pept        complement(220841..222802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0199"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: gwc:GWCH70_0182 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73050"
FT                   /db_xref="GOA:A0A0F6BHZ9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ9"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ADP73050.1"
FT                   /translation="MKRIGGKLLEKYRSLPDQYISFFIFAIFLFWMKTYAAYQAEFHLG
FT                   ISNSMQEFLLFINPVSSAVFFFGLALLAKGKRTYTWLIIINFVLSFILYANIVYYRFFS
FT                   DFITLPTLTQTKNFGDLGSSIWELIKWYDIFYFLDTVILIAIVTSKRFSLPAVQVGRYK
FT                   KSIVFAIAALIFSVNLALAEMDRPQLLTRTFDRNYIVKYLGVYNYLIYDAVQSMKSSTQ
FT                   RAFANKSDITTVLNHVQATYAKPNPQYFGVAKGMNVIYIHLESFQNFLINYKLHGQEVT
FT                   PFLNSLVRDPNTFYFDNFFHQTGQGKTSDAEFMLENSLFGLPQGAVFTTKGQNTYHAAP
FT                   ALLHQHGYTTAVFHGNYKTFWNRDEIYKSFGFDHFFDASYYDMSDENVLNYGLKDKPFF
FT                   RESIPLLESLREPFYVKFITLSNHFPYPISEEDATIEPANTGDGSVDRYFQTARYLDES
FT                   LKEFFDYLKKSGLYDRSVIILYGDHYGISENHNKAMSQVLGKEITPFEHAQLQRVPLFI
FT                   RVPGVKGGIMHQYGGQIDLLPTVLHLLGIDTKNYVHFGTDLLSPEHQEIVPFRNGDFVT
FT                   PTVTAVNGKYYDSKTGEPIPETPEVKQLEQIVRTKLDLSDKVVYGDLLRFYTPKGFKPV
FT                   DPTKYDYNNRDEEKKGSK"
     gtgaagagga ttggcggaaa gctgttagaa aaataccgtt ctctccctga tcaatatatc        60
     agttttttta tttttgccat atttttgttc tggatgaaaa catatgccgc ttatcaagct       120
     gaatttcatt taggcataag caattccatg caggaatttc tattatttat caacccggtt       180
     agttcggcgg ttttcttttt cggattggca ttattagcga aaggaaagcg gacatataca       240
     tggcttatta tcattaattt cgttttatcg tttattttat acgccaacat cgtgtactac       300
     cgatttttta gcgattttat tacgcttccg acgctaacgc aaacgaaaaa ctttggggat       360
     ttgggcagca gcatttggga attaatcaaa tggtacgata ttttctactt tttagatacg       420
     gtgatcttaa ttgccattgt cacttccaaa cgtttttcgc tgccggcagt ccaagtcggg       480
     cgttataaaa aaagcatcgt gttcgccatt gccgcgctta ttttcagcgt gaaccttgca       540
     ttggcggaaa tggaccgtcc gcaattgctg acaagaacgt ttgaccgcaa ttatattgtg       600
     aaatatttag gcgtttacaa ctatttgatt tatgacgccg tgcaaagcat gaaatcatcg       660
     acacagcgcg cttttgcgaa taaaagcgat attacgacgg ttttaaacca tgtgcaagca       720
     acgtatgcga aaccaaatcc gcagtatttc ggcgttgcca aaggaatgaa tgtcatttac       780
     attcatctgg aatcgttcca aaactttttg attaactata aattgcatgg ccaagaggta       840
     acgccatttt taaactcgct tgtgcgtgat cctaatacgt tttactttga taactttttc       900
     catcaaaccg gacaaggaaa aacgtcggac gctgaattta tgttagaaaa ctcgttgttt       960
     gggttgccgc aaggagcggt gtttacgaca aaagggcaaa acacctacca tgccgcaccg      1020
     gcgcttctgc accagcacgg atatacgacg gccgtattcc acggcaacta taaaacgttc      1080
     tggaaccgcg acgaaattta taaatcgttt ggtttcgacc atttctttga cgcaagctac      1140
     tatgacatga gcgatgaaaa tgtgcttaac tacggattaa aggataaacc gttctttaga      1200
     gagtcgattc cgttgctaga atcgttaaga gagccgttct atgtaaaatt tattacgctg      1260
     tcgaaccatt tcccttatcc aataagcgaa gaagatgcca cgatcgaacc cgcgaataca      1320
     ggcgatggct cggtcgaccg ttatttccaa acggcccgct atttggatga atcgttaaaa      1380
     gagttctttg attatctgaa aaaatccggc ttatatgacc gttctgtcat cattttatat      1440
     ggcgaccatt acggaatctc tgaaaatcac aataaagcga tgtcacaagt gctaggaaaa      1500
     gaaattacgc cgtttgaaca cgcgcaattg cagcgggtgc ctctattcat ccgcgtccct      1560
     ggcgtcaaag gcggaatcat gcatcaatac ggcgggcaaa ttgatttatt gccaacggtt      1620
     cttcacttat tgggaatcga cacgaaaaac tatgttcact tcggtacaga cttgttgtcg      1680
     ccagaacatc aagaaatcgt gccgttccgt aacggtgatt ttgtcactcc gaccgttaca      1740
     gcagtcaatg gaaaatatta cgattcaaaa acgggcgaac caattccgga aactccggaa      1800
     gtcaaacagt tggagcaaat cgtccgtact aaactcgacc tctcggataa agtcgtatat      1860
     ggcgacttgc tacgctttta cacaccaaaa ggattcaaac cggtcgatcc tactaaatat      1920
     gattacaaca atcgcgacga agaaaaaaag ggaagcaaat aa                         1962
//

If you have problems or comments...

PBIL Back to PBIL home page