(data stored in ACNUC7421 zone)

EMBL: CP002293.PE195

CP002293.PE195       Location/Qualifiers
FT   CDS_pept        223266..224606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0200"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   KEGG: gwc:GWCH70_0431 potassium uptake protein, TrkH
FT                   family; PFAM: cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73051"
FT                   /db_xref="GOA:A0A0F6BI00"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI00"
FT                   /inference="protein motif:TFAM:TIGR00933"
FT                   /protein_id="ADP73051.1"
FT                   /translation="MKKARKYYLDPPKVLVAGFAVIILVGTALLMLPIATNDGKGLPFL
FT                   DALFTATSATCVTGLVVVDTGTAFTLFGQLVILALIQVGGLGFMTFATLFAFLLGKRIS
FT                   LKERLLLQEAMNNLTIEGIVRLVKRVLIFTVVIELIGGLLLAVRFSFDMPLLKAFYFGM
FT                   FHAVSNFNNAGFDLMGNFRSLTGYVEDPVVTLVICALITLGGIGFIVMNEVYEYRQTRR
FT                   FSLHTKVAVATSGILLASSILLIFLLEFHNPNTLEPLSPLGKFLATLYQAVTPRTAGSN
FT                   TLNISDLTQPTLFLIIFLMFVGASPGSTGGGIKTTTFAILLGAVWSQIRGKEDVVFFKK
FT                   RIMYDTIYKSLTVTISGLFIVIFVTMLLTITEQGKDFLMILFEATSAFSTVGLSMGLTP
FT                   ELSPFGKVIIMCTMFAGRVGPLTIAYAVTLHRKPDPFRYPKGKIMIG"
     atgaaaaagg cacgaaaata ttatttagac cctccgaaag tgttagtagc tggatttgcc        60
     gtgattattt tggtcggcac agcgctgtta atgctgccga ttgcgacaaa tgacggaaaa       120
     ggccttcctt ttttagacgc gttgtttacg gcaacgtcgg cgacgtgtgt aacggggctg       180
     gtggtagtgg atacgggaac ggcgtttaca ttgttcgggc agcttgtgat tttggcgctg       240
     attcaagttg gcggacttgg atttatgaca tttgcgacac tttttgcgtt tttgcttgga       300
     aaacgaattt ctttaaaaga acggttattg cttcaagaag cgatgaataa tttgaccata       360
     gagggaattg ttcgtttagt gaagcgggta ttaattttta ctgttgtgat tgagctgata       420
     ggcggtttat tgttagcggt tcgtttctcg tttgacatgc cgttgttaaa agctttttat       480
     tttggcatgt ttcatgcggt ctctaatttt aataacgccg gttttgattt aatggggaat       540
     ttccgcagtt tgacaggata tgtggaagat ccggttgtca cacttgttat atgtgcgctt       600
     attacattgg gcggaatcgg gtttatcgtg atgaatgaag tatatgaata tcggcagacg       660
     cgccgctttt cattgcatac gaaagtggcg gttgccacaa gcggcatatt gttggcgtcc       720
     agcattttgc ttattttttt acttgagttt cacaacccga acacgcttga gccattatcg       780
     ccgcttggca agtttttggc cactctttat caagcggtaa caccgagaac agccggatcg       840
     aacacgttaa atatttctga tttaacgcaa ccgacattgt ttttgatcat ctttcttatg       900
     tttgttggcg cctctcccgg ttcaaccggc ggcggcatca agacaaccac ttttgcgata       960
     ttgttgggag cggtttggtc gcaaataaga ggaaaagaag atgtagtctt ttttaaaaaa      1020
     cggattatgt atgatacgat ttataaatcg ctgaccgtga cgatcagcgg attgttcatc      1080
     gtcatatttg taacgatgtt gctcactatt acggaacagg gaaaagattt tttaatgatt      1140
     ttatttgaag caacgtcggc gtttagcacg gtaggattat cgatgggact gacaccggag      1200
     ctgtctccat tcggaaaagt gatcattatg tgcacgatgt ttgccggaag ggtcgggcca      1260
     ttaacgatcg cttacgctgt aacgttgcat cgcaagccag atccgttccg ttatccgaaa      1320
     gggaaaatta tgattggcta a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page