(data stored in SCRATCH zone)

EMBL: CP002293.PE199

CP002293.PE199       Location/Qualifiers
FT   CDS_pept        230790..232019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0205"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="TIGRFAM: amidase, hydantoinase/carbamoylase family;
FT                   KEGG: gwc:GWCH70_3176 amidase, hydantoinase/carbamoylase
FT                   family; PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73055"
FT                   /db_xref="GOA:A0A0F6BI04"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI04"
FT                   /inference="protein motif:TFAM:TIGR01879"
FT                   /protein_id="ADP73055.1"
FT                   /translation="MINGDRLWNRLLELGTIGKQPSGGITRLSFTKEERAAKEKVVSYM
FT                   KEAGLAVYEDAVGNLIGRKEGKEKDAPAVLVGSHIDSVYNGGMFDGPLGVLAAVEVLQT
FT                   MNERGVKTKHPIEVVAFTDEEGARFSYGMIGSRGMAGTLSEEELVHQDKHGISLAAAME
FT                   EAGLDPGKIGKAARRKGSVKAYVELHIEQGRVLEQANLPVGIVTGIAGLIWAKLTITGK
FT                   AEHAGATPMPIRRDPLVAAAQIIQVIEQEAKKTGTTVGTVGQMQVFPGGINIIPERVEF
FT                   SLDLRDLDAAVRDSVFLSIIERAKQIGNERNVDVAVELLQKMPPVLCSELVQNAAKEAC
FT                   RQLGFDVFTLPSGASHDGVQLAGLCPIGMIFVRSKDGVSHSPEEWSSKEDCAAGANVLY
FT                   HTVLSLAMTA"
     atgattaatg gagaccggct ttggaaccgc ttgttggaat taggaaccat cggaaagcag        60
     ccttctggag ggataacccg cttatcgttt acaaaggaag aacgcgccgc aaaggagaaa       120
     gtcgtttctt acatgaaaga agcagggctt gctgtatatg aagatgctgt tggcaattta       180
     atcgggcgca aagaaggaaa agaaaaagac gcacctgccg tgcttgttgg gtcgcatatt       240
     gattcagttt ataacggggg aatgtttgac ggcccgctcg gggtgcttgc cgctgtggaa       300
     gtattgcaga cgatgaacga gcgcggggtg aaaacgaagc atccgattga agtcgttgcc       360
     tttacggatg aagaaggggc tcgttttagt tacggaatga tcggcagccg cgggatggcg       420
     ggaacgttgt cagaggaaga acttgttcat caagacaaac atgggatttc gcttgccgct       480
     gcgatggaag aagcggggct tgaccctggc aaaatcggca aggcggcgcg gcgcaaaggc       540
     tcggtgaaag catatgtcga gttgcatatc gaacaagggc gtgtgctgga acaagcgaat       600
     cttcccgtcg gcattgtcac agggattgcc gggctcatat gggcgaaatt aacgatcacc       660
     ggaaaagcgg aacatgccgg agcgacgcca atgcccattc gccgcgatcc gcttgttgct       720
     gcggcacaga ttatccaagt catcgagcaa gaggcgaaaa aaacgggaac gaccgttggc       780
     actgtcggac aaatgcaggt gttcccagga ggaattaata tcattccgga gcgggtcgaa       840
     ttttccttag atttgcggga tttggacgcg gctgtgcgcg atagcgtatt cctgtcgatt       900
     atcgaacggg cgaaacaaat tggcaatgag cgaaacgtgg acgttgcggt cgaattattg       960
     caaaagatgc ctccagtatt atgttccgag cttgtgcaaa acgcagcgaa agaggcatgc      1020
     cggcagcttg gttttgatgt tttcactctt ccgagcggcg cttcccatga tggagtgcag      1080
     cttgccggac tttgtccgat tgggatgatt tttgtccgtt cgaaagatgg ggtcagccat      1140
     agcccggagg aatggagttc gaaggaagac tgcgcggccg gagcgaatgt tttgtatcat      1200
     acggtgttaa gtttggcgat gacagcataa                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page