(data stored in ACNUC7421 zone)

EMBL: CP002293.PE2

CP002293.PE2         Location/Qualifiers
FT   CDS_pept        1957..3093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: gwc:GWCH70_0002 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72858"
FT                   /db_xref="GOA:A0A0F6BHF7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHF7"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADP72858.1"
FT                   /translation="MKITIDREALVQSVQDVMKAVSPRTTIPILTGIKITATPQGVTLT
FT                   GSDSDISIESFIPMEDEDKVLVEIAETGSIVLQARFFSEIVKKLPEKTVEIEVQPNFLT
FT                   VIRSGKAEFSLNGLDAEEYPRLPQIEEENVFEIPTDLLKTIIRQTVFAVSVSETRPILT
FT                   GVNWRIEDEELICTATDSHRLALRKAKIETENHQSHNVVIPGKSLNELSKILDDSNAPV
FT                   KIVITANQILFKTKRLLFFSRLLDGNYPETSRLIPTDSKTDIIVNAKEFLQAIDRASLL
FT                   AREGRNNVVKLTTLSDGIIEISSVSPEIGKVTEEIQSESIEGEELKISFSAKYMMDALK
FT                   ALDGTDIKISFTGAMRPFLLRPLHSDSMLQLILPVRTY"
     atgaaaatta caatcgatcg agaagcattg gttcaaagtg tccaagatgt catgaaagct        60
     gtgtcccctc gcactactat tccgattttg acaggaataa aaattacggc aaccccgcaa       120
     ggagtcacgt taacaggaag cgattccgac atttcaattg aatcttttat cccaatggaa       180
     gacgaagata aagtacttgt cgaaatagca gaaaccggca gcattgtgct gcaagcccgc       240
     tttttttcag aaatcgtaaa aaaactgccg gaaaagacag ttgaaatcga agtacagcct       300
     aatttcttaa ccgtgattcg ttcaggaaaa gcggaattta gcctaaatgg tctcgacgcc       360
     gaagaatatc caagacttcc gcaaatcgaa gaggaaaatg ttttcgaaat tccaacggac       420
     ttgttaaaaa cgattatccg gcaaacggta tttgccgttt ccgtttcaga aacgcggcca       480
     atcttgacag gtgtcaactg gagaatcgaa gacgaggaac taatctgtac tgcaacagac       540
     agccaccgcc ttgcattgcg aaaagcaaaa attgagacgg aaaatcacca gtcgcataat       600
     gtcgtcattc cgggaaaaag cttaaacgaa ctgagcaaaa ttttggatga cagcaatgct       660
     cctgtcaaaa ttgttattac ggcgaatcaa attttattta aaacaaaacg tttattattc       720
     ttctctcgct tgcttgatgg aaactatccg gaaacatccc ggcttattcc aacggatagc       780
     aaaacggata ttatcgtgaa tgcgaaagag tttttacaag caattgatcg cgcttcttta       840
     ttagcgagag aaggaagaaa caatgttgtc aaactaacga cgctcagtga tggcatcatt       900
     gaaatttcct ccgtttcacc ggaaatcgga aaagtaacgg aggaaattca aagcgaatct       960
     atcgaaggag aggaattaaa aatttctttc agcgcaaaat atatgatgga cgcgttaaaa      1020
     gcgcttgacg gtacagacat taaaatcagc tttaccggcg cgatgcggcc gtttttgctt      1080
     cgccctctcc atagcgactc gatgcttcag cttattttac cggtaagaac gtattaa         1137
//

If you have problems or comments...

PBIL Back to PBIL home page