(data stored in ACNUC7421 zone)

EMBL: CP002293.PE203

CP002293.PE203       Location/Qualifiers
FT   CDS_pept        complement(236100..237176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0210"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: gwc:GWCH70_3171 mandelate racemase/muconate
FT                   lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73059"
FT                   /db_xref="GOA:A0A0F6BI08"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI08"
FT                   /inference="protein motif:PFAM:PF02746"
FT                   /protein_id="ADP73059.1"
FT                   /translation="MKIKDATIAVQSTPLIKPFKTALRTATQIESIVVKITLDNGMEGY
FT                   GAAVPTEAITGETKQGIIGVLENVLIPKIIGREIEEINKNDKDIQTSCIGNTSAKAALE
FT                   MAMYDALCKLLNIPLYQLFGGKMNHHVNDMTISVNNVEEMVNDAKKVTEKGFSILKIKV
FT                   GKEAEKDIERIERIYDEVGPNISLRIDANQGWTAKDAVKIIQSLEQLHLPIEFIEQPVS
FT                   KHDIKGLQFIRERVNVPIMADESVFSARDALELIRHHAVDLINIKLMKTGGLREAYKIA
FT                   SLAEAAGIECMIGSMMEPTLSVLAAAHLAMAHPNITKVDLDAPLWINDDSSRSFFQESK
FT                   INVPDLPGIGYVPSMPNH"
     atgaaaataa aagacgcaac gatcgccgta caatctaccc cattgataaa acctttcaaa        60
     acggcattgc ggacagctac acaaatagaa agcatcgtcg taaaaatcac gctggataac       120
     ggaatggaag gctatggggc cgccgtcccg accgaagcca tcacaggaga aacaaaacaa       180
     ggaatcatag gtgttttaga aaatgttctc atccccaaaa tcatcggtag agaaattgaa       240
     gaaatcaata aaaacgataa agatatccaa acaagctgca ttgggaatac aagcgcaaaa       300
     gcggcattag aaatggctat gtacgatgcg ctttgcaaac tgctaaacat tccgctttat       360
     caattattcg gaggaaagat gaaccatcat gtcaacgata tgaccattag cgtaaataat       420
     gtagaagaaa tggtcaatga cgcaaaaaaa gtcacagaga aaggtttttc gattttaaaa       480
     attaaagtag gaaaagaagc cgaaaaagat atcgaacgaa ttgaacgaat ttatgatgaa       540
     gtaggtccaa acatttcgct tcgcattgat gccaatcaag gatggacagc gaaagatgcg       600
     gtgaaaatca tccaatcgct agaacaactt catcttccga ttgaatttat tgaacagccc       660
     gtttctaaac atgacataaa aggcctccag tttatccgtg aacgagtcaa cgtaccaatt       720
     atggcggacg aaagtgtatt ctcggcgcga gatgcactag agctgatccg tcatcacgct       780
     gttgatttaa tcaatattaa gctgatgaaa acgggcggac tacgggaagc ttacaagatt       840
     gctagtctag cggaagcggc cggtatcgaa tgcatgatcg gaagcatgat ggagccaact       900
     ctttctgtat tggcagcagc ccatttagca atggcccatc cgaacattac aaaagtcgat       960
     ttagatgccc ctctatggat aaacgatgac agcagccgtt ctttctttca agaaagtaag      1020
     attaacgttc ctgatttacc aggtattggt tatgtccctt ctatgcccaa tcattga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page