(data stored in ACNUC7421 zone)

EMBL: CP002293.PE207

CP002293.PE207       Location/Qualifiers
FT   CDS_pept        240095..240991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0214"
FT                   /product="ribokinase"
FT                   /note="KEGG: gwc:GWCH70_3167 ribokinase; TIGRFAM:
FT                   ribokinase; PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73063"
FT                   /db_xref="GOA:A0A0F6BI12"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI12"
FT                   /inference="protein motif:TFAM:TIGR02152"
FT                   /protein_id="ADP73063.1"
FT                   /translation="MTKPVITVVGSINMDLVTIASRFPSQGETILGEEFHLIPGGKGAN
FT                   QAVAAARLGAEVHMIGAVGTDPFGNELLRSLEREGVHIDNVKPVTHKGTGIASITILEQ
FT                   DNRIIVVPGANHALRPEDIDRYEEIIAKSDVCVLQLEIPLSVVERAVFLAKKHHVRVIL
FT                   NPAPAQPLPQKLIEQADFLTPNEHEREIIFEQVDVDVFADKVIVTEGARGVTIRKDGKQ
FT                   VLIPSFCVPVVDTTGAGDTFNGALAVALSKGMSLEDACRFANAAAALSVTKLGAQGGMP
FT                   TEEEVKKFLQEKAGCSS"
     atgacgaaac cggtgattac tgttgttgga agcatcaaca tggatcttgt gacgatcgct        60
     tctcgttttc catcgcaagg agaaacaatt ttaggagagg agtttcatct cattcctggc       120
     ggaaaaggcg ctaaccaagc ggtggctgcc gcgcggcttg gcgcggaggt acatatgatt       180
     ggggccgtcg gaacggatcc atttggaaac gagcttcttc gctcattgga gcgggaaggt       240
     gttcatatcg ataatgtgaa accggttaca cataaaggca ctggtattgc ttcgatcacg       300
     attttggaac aagataaccg gattattgtt gtgccgggag cgaatcatgc gcttcgccca       360
     gaagacattg accggtacga agagatcatt gccaagagcg atgtatgtgt actgcaactg       420
     gaaattccgc tttccgttgt agaaagagcc gtcttcttag cgaaaaaaca tcatgtgcgt       480
     gtcattttaa atccagcgcc agcgcagccg ttgccacaaa aactcatcga gcaggccgat       540
     tttcttacac caaatgaaca tgagcgggag attatttttg agcaagtgga tgtggatgtg       600
     tttgctgata aagtgattgt cacagaggga gcacgcggcg tgacgattcg gaaagatgga       660
     aaacaggtgc tcataccaag cttttgcgtt ccggtcgtgg acacgacagg agcaggagat       720
     acattcaacg gtgcgttggc ggtcgcgtta agcaaaggaa tgagtttgga agatgcatgt       780
     cgctttgcca acgctgcggc ggcgttatcg gtgacaaaac ttggcgcgca aggcggaatg       840
     ccgacggaag aggaagtaaa gaaatttttg caggaaaagg cagggtgttc atcatga          897
//

If you have problems or comments...

PBIL Back to PBIL home page