(data stored in ACNUC7421 zone)

EMBL: CP002293.PE208

CP002293.PE208       Location/Qualifiers
FT   CDS_pept        240988..241386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0215"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: RbsD or FucU
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73064"
FT                   /db_xref="GOA:A0A0F6BI13"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI13"
FT                   /inference="protein motif:PFAM:PF05025"
FT                   /protein_id="ADP73064.1"
FT                   /translation="MKKRGILNKDLSMLLASLGHTDTIVIADCGLPIPNGTDRIDLSLV
FT                   KGFPPFLSVLDAVLEELEVEALTLAEEIKKENPIMYENIQQRLSDVPMQFVPHEQLKEM
FT                   TKSAKAVIRTGEATPYANIILRSGVNFS"
     atgaaaaaac ggggtattct caataaagac ttaagtatgc tattggcttc tctcggtcat        60
     accgatacga ttgtcatcgc agactgcggt ctgccgattc cgaatgggac agatcgtatt       120
     gatttatcgc tagtgaaggg atttccgccg tttttatccg tgctggatgc ggttttagaa       180
     gaattagaag ttgaagcgct aacattagcg gaagaaatca aaaaggaaaa tcccattatg       240
     tatgaaaaca tccagcaaag attgagcgat gtaccgatgc aatttgttcc acacgaacag       300
     cttaaagaga tgacaaaatc cgcaaaagcg gtcattcgta caggggaggc gacgccttac       360
     gctaatatta ttctccgctc tggcgtgaac ttttcatag                              399
//

If you have problems or comments...

PBIL Back to PBIL home page