(data stored in SCRATCH zone)

EMBL: CP002293.PE209

CP002293.PE209       Location/Qualifiers
FT   CDS_pept        241414..242910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0216"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: afl:Aflv_2670 ABC-type ribose transport
FT                   system, ATPase component; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73065"
FT                   /db_xref="GOA:A0A0F6BI14"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI14"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP73065.1"
FT                   /translation="MTKPFVEMRGIKKAFHQHVVLNDVDFEVRAGEVHALMGENGAGKS
FT                   TLMKVLTGIYERDAGTVLVDGREVHYRHPKEAERDGISVIHQELTIIPTLTVAENIFLG
FT                   RESTIGRTGIIRGKDMEKQAKVYLEKLGIHIDPNELAGNLSVGKQQIVEIARALSTNAK
FT                   CLIMDEPTAALTEREIQTLFEVIRTLKQQGVAIVYISHRMEEIFTICDRISVLRDGQFI
FT                   GTKRIAETNFDEIVHMMVGRQIGERFPKRNTIIGEERMRVEGLTQEGVFENVSFSVRAG
FT                   EILGVAGLMGSGRTEIMEAIFGARKMNAGTIYIDGQPVHITSPRRAIEHGIAMITEDRK
FT                   QKGLILDMSVRENLTLPKSEQLAAAGVIQATKEQELVSSLIKKLNIKTASPELEVKALS
FT                   GGNQQKVVFGKWLAMEPRILILDEPTRGVDVGAKKEIYEIMNELTAQGVAIIMVSSELP
FT                   EVLGMSDRIMVVHEGKVRAILENEGIDQETIMRAATGGKA"
     atgacgaaac cgtttgttga gatgcggggt attaaaaaag cgttccacca gcatgttgtc        60
     ttaaacgatg tcgattttga agtgcgcgcc ggtgaagtgc acgcgctcat gggagaaaac       120
     ggcgccggaa aatcgacgtt aatgaaagta ttaactggca tttatgagcg cgatgctggg       180
     acggtcttgg tggatggccg cgaagtgcat tatcgtcatc cgaaggaagc ggaacgtgat       240
     gggatttctg ttattcatca ggaacttacc atcattccga cattgacggt tgcggaaaat       300
     attttcctag gacgcgaaag cacgatcggc cgtaccggta ttattcgcgg caaagacatg       360
     gaaaagcagg cgaaagtgta tttggaaaaa ctcggcatcc atattgatcc gaatgagttg       420
     gcaggcaatt tgtcggtagg aaaacagcaa attgtcgaaa ttgcaagggc gctttccacc       480
     aacgccaaat gtttaattat ggatgagccg actgccgcgt tgacggagcg ggaaattcaa       540
     acgttgtttg aagtcatccg caccttaaag cagcaagggg ttgcgatcgt ttatatttcg       600
     caccgcatgg aggaaatttt cacgatttgc gaccgcattt ccgtactccg agacgggcag       660
     tttatcggca cgaagcgcat tgccgagaca aattttgatg agattgtcca catgatggtt       720
     ggccggcaaa ttggagagcg ctttccaaag cgaaatacaa tcattggcga agaacggatg       780
     cgcgtggaag gattgacaca ggaaggggtc tttgaaaatg tttcgttttc ggtgcgcgct       840
     ggtgaaattc tcggtgtggc tggattgatg ggatcaggac gtaccgaaat aatggaggcg       900
     atttttggcg caagaaaaat gaacgcggga acgatttata ttgacggcca accggttcat       960
     attacatcgc caagacgagc gattgagcac ggcatcgcaa tgattacaga agatcgcaaa      1020
     caaaaagggc ttattttgga tatgagtgtg cgcgaaaatt taacgttgcc aaaatcagaa      1080
     caattggcgg cagccggtgt cattcaagcg acgaaagagc aggagttagt ttcgtcgtta      1140
     attaagaaac taaacattaa aacggcgtct ccggaattag aggtaaaagc gttaagcgga      1200
     ggcaaccagc aaaaagtcgt attcggaaaa tggctggcga tggagccgcg catccttatt      1260
     ttagatgaac caacgcgcgg ggttgatgtt ggcgccaaaa aagaaattta tgaaattatg      1320
     aatgaactga cggcacaagg ggttgcgatt attatggtat cgtccgagct cccggaagtg      1380
     cttgggatga gtgaccgcat tatggttgtt catgaaggga aggttcgcgc tattttggag      1440
     aatgaaggaa tcgatcaaga aacgattatg cgtgcggcga caggaggaaa agcataa         1497
//

If you have problems or comments...

PBIL Back to PBIL home page