(data stored in ACNUC7421 zone)

EMBL: CP002293.PE21

CP002293.PE21        Location/Qualifiers
FT   CDS_pept        29893..30117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0021"
FT                   /product="Protein of unknown function DUF2508"
FT                   /note="PFAM: Protein of unknown function DUF2508; KEGG:
FT                   gwc:GWCH70_0022 conserved hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72877"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH6"
FT                   /inference="protein motif:PFAM:PF10704"
FT                   /protein_id="ADP72877.1"
FT                   /translation="MLWRRKGWLKKQFDLKLIEQLQAARDEWYGQKQLIEKSVEPSEEV
FT                   LMTLHVAEAKYFFLMREAKYRRVSLKGVK"
     ttgttatggc ggcggaaagg ctggttgaaa aaacagtttg atctgaaatt aatagaacaa        60
     ttgcaagcag cgcgcgatga atggtatgga cagaaacagt tgattgaaaa aagtgtggaa       120
     ccttcagagg aagtgctgat gacattgcat gttgcagaag ccaaatactt ttttttaatg       180
     cgggaagcga aataccgacg tgtatcatta aagggagtga aatag                       225
//

If you have problems or comments...

PBIL Back to PBIL home page