(data stored in ACNUC7421 zone)

EMBL: CP002293.PE210

CP002293.PE210       Location/Qualifiers
FT   CDS_pept        242910..243851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0217"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73066"
FT                   /db_xref="GOA:A0A0F6BI15"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI15"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADP73066.1"
FT                   /translation="MENKWNFDVKKLGPLIGFFLLCIVLSILSDSFLTVNNWMNVLRQV
FT                   SINALIAFGMTFVILTGGIDLSVGSVLALSSAITAGIMASGTNGFTAIIIGLLAGFLMG
FT                   ALNGVVITKGRIAPFIATLATMTMFRGLTLVYTDGRPITGFASDDILFQMMGRGYFLGI
FT                   PVPVVFMIVVYVALYFVLKKTTFGRHTYAIGGNEEASRLSGIRVDRLKIWIYSLTGGLS
FT                   ALAGIILTSRLNSAQPTAGTAYELDAIAAVVLGGTSLSGGRGWIFGTLVGALIIGVLNN
FT                   GLNLLNVSSFYQQVIKGLVILLAVLLDRRKEA"
     atggaaaaca aatggaattt tgatgtaaaa aagcttggcc cgcttattgg tttcttcttg        60
     ttatgtattg tgctgtcgat attgagtgac agtttcctaa cggtcaataa ctggatgaac       120
     gttttgcgtc aagtgtcgat taacgcgtta atcgcgtttg gcatgacatt cgtcatttta       180
     acgggaggca ttgatttatc ggtcggttcc gtgttagcgc tctcaagtgc gattactgcg       240
     ggaataatgg caagcgggac gaatggcttt actgctatca tcatcggatt gcttgccggc       300
     tttctcatgg gtgcactaaa cggtgtggtg attacgaaag gacgcattgc tccgtttatt       360
     gccactctag caacgatgac gatgtttcgc ggattaaccc ttgtttatac agatgggcgt       420
     cctatcactg gttttgcctc agacgatatt ttgtttcaaa tgatgggacg cgggtatttt       480
     ctcggcatcc ctgttccggt tgtatttatg attgtcgtgt atgtcgcatt atattttgta       540
     ttaaagaaaa cgacgtttgg ccgtcatacg tatgcgattg gtggaaatga ggaagcgagc       600
     cgtctatccg gaattcgcgt cgatcgactg aaaatttgga tttattcctt aactggagga       660
     ttgtcggcat tagcaggaat tattttaacc tcccgcttaa actcggcgca gccaacggcg       720
     ggaacagcgt atgaattaga tgcgatcgct gccgtggtgc tgggagggac cagtttatcc       780
     ggcggccgcg gctggatttt cggaacgttg gttggtgcgc ttattattgg tgtattgaac       840
     aacgggctga acttattgaa tgtatcttca ttttatcagc aagtcattaa agggttagtc       900
     attcttcttg cggtgctcct tgaccgccgc aaagaagctt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page