(data stored in ACNUC7421 zone)

EMBL: CP002293.PE215

CP002293.PE215       Location/Qualifiers
FT   CDS_pept        248831..250018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0222"
FT                   /product="catalytic domain-containing protein of components
FT                   of various dehydrogenase complexes"
FT                   /note="PFAM: catalytic domain-containing protein of
FT                   components of various dehydrogenase complexes;
FT                   biotin/lipoyl attachment domain-containing protein; E3
FT                   binding domain protein; KEGG: gwc:GWCH70_3162 catalytic
FT                   domain of components of various dehydrogenase complexes"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73071"
FT                   /db_xref="GOA:A0A0F6BI20"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI20"
FT                   /inference="protein motif:PFAM:PF00198"
FT                   /protein_id="ADP73071.1"
FT                   /translation="MRYEFKLPDIGEGLHEAEIVRWFIQEGDEVAADQPIAEIQTDKAM
FT                   VEMTTPVAGKVVALAGPEGMTVKVGEPLIILEQQKAAIAESRPAQQKKRVIAAPSVRKR
FT                   AREMGIPIEEVEGTGEGGRVTLADLERYAKARESALEPVAPALEAAGRKMDRRHGITEH
FT                   EERIPIRGLRKKIAEKMVKSAYTAPHVTGMDEIDVTKLVEIRASLAKQLEAEAIKLTYL
FT                   PFVIKAVTRALKEYPLLNAAIDEETNEIVLKKQYHIGIATATKEGLVVPVIKHADQKSI
FT                   HDLAVEIAELSEKARRHALRIDELQGSTFTITNTGANGGWFATPIINYPEVAILGIHAI
FT                   KRKPVVIGEEIVIRDMMGMSLTFDHRVIDGEPAGRFMRAVSHILEHPEQLLLDVR"
     atgcgttacg agtttaaatt gccggacatc ggcgaagggt tgcatgaagc ggagatcgtt        60
     cgctggttta ttcaagaagg ggatgaggtc gccgccgatc agccgatcgc agaaattcaa       120
     acagataagg cgatggtgga aatgacgacg ccagtggcgg ggaaagtagt agcgcttgcc       180
     gggccggagg ggatgacggt aaaagtcggc gaaccgctta ttattcttga acagcaaaaa       240
     gccgctatcg cagaatctag gccggcgcaa cagaaaaaac gggtgattgc cgcgccgtcc       300
     gttcgaaagc gggcgagaga aatgggcatc ccgattgaag aagtggaagg aacgggagaa       360
     ggcggaaggg tgacgcttgc tgatttagag cggtatgcaa aagcgcgcga gtccgcactg       420
     gagccggtgg cgccagcgct ggaagcagcc gggcggaaaa tggatcgccg gcacgggata       480
     actgaacatg aagaacgcat tccgatccgc gggctgcgaa aaaagatcgc ggaaaaaatg       540
     gtgaaatcgg cgtacaccgc accgcatgtg acaggaatgg acgaaatcga tgtgacgaaa       600
     ctggtggaga ttcgcgcaag tcttgccaaa cagctggaag cggaagcgat caagctgact       660
     tatttgccgt ttgtcattaa agcagtgacg cgcgcgttaa aggaatatcc gctattgaat       720
     gcggcgatcg atgaagaaac aaacgaaatc gtgctaaaga aacaatacca tatcggcatt       780
     gccacggcga cgaaagaagg gcttgtcgtg ccggtgatta agcatgccga tcaaaaatcg       840
     attcacgatc ttgccgtgga gattgccgag ctttcggaaa aggcgcgccg ccatgcgctg       900
     cgcattgacg agctgcaggg aagcacgttt acgatcacga atacaggcgc aaacggcggc       960
     tggtttgcaa cgccgatcat taactatccg gaagtggcga ttttagggat tcatgcgatt      1020
     aagcgaaagc cggtcgtgat tggcgaggaa attgtcattc gcgacatgat ggggatgtcg      1080
     ctcacgtttg atcatcgcgt catcgacggg gaaccagccg ggcggtttat gcgggcggtc      1140
     tcgcacattt tggagcatcc ggaacagctg ttattagatg ttcgttaa                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page