(data stored in ACNUC7421 zone)

EMBL: CP002293.PE217

CP002293.PE217       Location/Qualifiers
FT   CDS_pept        251134..252096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0224"
FT                   /product="Transketolase central region"
FT                   /note="KEGG: gwc:GWCH70_3160 transketolase central region;
FT                   PFAM: Transketolase central region; Transketolase
FT                   domain-containing protein; SMART: Transketolase central
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73073"
FT                   /db_xref="GOA:A0A0F6BI22"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI22"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ADP73073.1"
FT                   /translation="MIQAINEAIRQEMERDERVIVLGEDVGKNGGVFRATDGLFEQFGD
FT                   RRVFDTPLAESGIIGTSIGLAVNGFRPVAEIQFLGFAYQAMDQLAAQAARLRFRSAGRF
FT                   TCPLVVRSPYGGGVRTPELHSDALEALFTHSPGLKVVMPSNAFDAKGLLISAIRDEDPV
FT                   LFLEPMKLYRALRMEVPDEPYEIPLGTARVVKEGEDVTIISWGATVPLVAKLAEEMKEK
FT                   GIDAEVIDLRSLQPLDIDAIVQSVEKTGRVMVVHEAVKTNGFGAEIAALISERALFSLS
FT                   APIVRVTGYDTPYPVPSVEDEWLPNAARIVEGVQMLMRY"
     atgattcagg cgattaatga agcgatccgg caagaaatgg agcgcgatga gcgcgtgatc        60
     gtcctggggg aggatgtcgg aaagaacggc ggcgtctttc gcgcgacaga tggcttgttt       120
     gaacaatttg gcgaccgccg cgtgtttgat acgccgcttg ccgaatcagg aatcatcggc       180
     acctcgattg gcttggcggt gaacggattc cgcccggttg cggaaatcca gtttctcggt       240
     tttgcctacc aagcgatgga tcagcttgcg gcacaggcgg cgcgccttcg cttccgttca       300
     gcggggcggt ttacgtgccc gcttgtcgtg cgcagcccat acggcggcgg ggtgcgcacg       360
     ccggagcttc attccgatgc gttagaggcg ttgtttacgc attcaccggg actgaaagtc       420
     gttatgccat ccaacgcttt tgacgcaaaa gggctgttaa tttcagcgat tcgcgatgaa       480
     gatcctgttt tgtttttaga gccgatgaaa ttataccgtg ctttgcgcat ggaagtgccg       540
     gatgagccat atgaaattcc gctcggaaca gcgcgcgtcg tcaaagaggg ggaagatgta       600
     acgatcattt catggggagc gacggttccg cttgtcgcga aattagcgga agagatgaag       660
     gagaaaggaa tcgatgcgga ggtgatcgat cttcgcagcc tgcagccgct cgatatcgat       720
     gcgatcgtgc agtcggtgga aaagacggga cgggtgatgg ttgttcatga agcggtcaaa       780
     acaaacggtt ttggcgcgga aattgccgcg ctgattagcg aacgggcgct gttctcgcta       840
     tcggcgccga ttgtgcgcgt gaccggttat gatacaccgt atccggtgcc atcggtcgaa       900
     gatgagtggc tgccgaacgc cgcccgcatc gttgaaggag tacaaatgct catgcgctac       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page