(data stored in SCRATCH zone)

EMBL: CP002293.PE218

CP002293.PE218       Location/Qualifiers
FT   CDS_pept        252114..253478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0225"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   gwc:GWCH70_3159 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73074"
FT                   /db_xref="GOA:A0A0F6BI23"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI23"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADP73074.1"
FT                   /translation="MGVYEDLLEQIGDRERVTVNETVLEQHSKGIAYHAPRKPDVVVFP
FT                   KTAAEVSAVLAYANERRIPVTPFGAGSSLEGHIIPVQGGITLNLTMMNHIIDIRPDDFL
FT                   AIVEPGVTRMQLNQALKKYGLFFPVDPGADATLGGMAATNASGTNSVKYGVMRDQVLGL
FT                   EVVLADGKIVHTGGMAAKSSAGYDLTGLFVGSEGTLGVFTKMIVRLQGIPEATNAIKAS
FT                   FPTLTAAAQAAALLLKAGVSPGKIELVDEQTIQAVNQYKQTNYPEAPTLFIELSGSAAS
FT                   VKDGTEVVKEWCAAENAVSFETEDDPAGRAKLWEARHHAAFAIQAAHPGKTMLSTDVCV
FT                   PVSKLPEAIAETRKLVDEYGITAAIFGHVGDGNYHTVLTFDPADAEEVKRVEEINARIV
FT                   RYALSHGGTCTGEHGIGIGKRHFLYEEHRDSVPLMQGIKRLFDPNGIMNPGKIFL"
     atgggagttt atgaagactt attagaacag attggtgacc gtgaacgggt gacggtgaac        60
     gaaacggttc tcgaacagca tagcaaagga atcgcgtatc atgcgccaag aaagccggat       120
     gtcgtcgtgt ttccgaaaac ggcggcggaa gtgagcgctg tgttggctta tgcaaatgag       180
     cggcgcatcc cggttacccc gtttggggcg ggaagcagct tagaagggca tattattccc       240
     gtccaaggcg gcatcacgct caatcttacg atgatgaacc atattattga tatccgcccc       300
     gatgattttt tggccattgt cgagccggga gtaacgcgga tgcagctgaa tcaagcgttg       360
     aaaaaatacg ggctgttttt cccggttgac ccgggagcag acgcgacgct cggcgggatg       420
     gcggcgacga acgcgagcgg gacaaacagt gtcaaatacg gcgtgatgcg cgatcaagtg       480
     cttgggctgg aagtcgtgct tgccgacggg aaaatcgttc ataccggagg aatggcggca       540
     aaatcgtcgg ctggttatga tttaacgggg ctgtttgtcg gatcggaagg aacgctgggc       600
     gtatttacga agatgattgt ccgccttcaa ggcatcccgg aagcgacgaa tgcgatcaaa       660
     gcaagctttc cgacgttaac ggcggcagcc caggcggcag cgttgctttt aaaagcgggt       720
     gtttctccgg ggaaaatcga gcttgtcgat gagcaaacga ttcaagcggt caatcaatac       780
     aagcagacga actatccgga ggcgccgacg ctgtttatcg aattaagcgg cagcgcggcg       840
     agcgtcaaag acggaacgga agttgtcaaa gaatggtgcg ccgcagaaaa cgctgtgtca       900
     tttgaaacgg aagatgatcc cgccgggcgc gctaaattgt gggaagcgcg ccatcatgcg       960
     gcgtttgcca ttcaagcggc gcatccgggg aaaacgatgt tgtccaccga tgtatgtgtg      1020
     ccggtttcca agctgccgga agcgattgcc gaaacgcgga agcttgtcga tgaatacggg      1080
     ataacagcgg cgattttcgg ccatgtcggc gacggcaact accataccgt tcttaccttc      1140
     gatccggctg acgccgaaga agtgaaacgt gttgaagaaa taaacgcccg catcgtccgc      1200
     tacgcgttat cccatggcgg cacatgcacg ggcgagcacg gcattggcat cggaaaacgt      1260
     catttcttat atgaggagca tcgcgattcc gttccgctca tgcaagggat caagcggctg      1320
     tttgacccga atggcattat gaatccagga aaaattttct tataa                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page