(data stored in ACNUC7421 zone)

EMBL: CP002293.PE219

CP002293.PE219       Location/Qualifiers
FT   CDS_pept        253670..255106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0226"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number="3.2.1.86"
FT                   /note="KEGG: gtn:GTNG_3135 beta-glucosidase-like protein;
FT                   PFAM: glycoside hydrolase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73075"
FT                   /db_xref="GOA:A0A0F6BI24"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI24"
FT                   /inference="protein motif:PRIAM:3.2.1.86"
FT                   /protein_id="ADP73075.1"
FT                   /translation="MEHKQLRPFPDRFLWGSASAAYQVEGAWNEDGKGLSVWDVFAKQP
FT                   GRTFKGTNGDVAVDHYHRYKEDVALMAEMGLKAYRFSVAWSRVFPNEKGEINEKGLQFY
FT                   DNLINELLKHNIEPIITLYHWDVPQALMDEYGAWESRQIIDDFHDYAVTLFQRFGDRVK
FT                   YWVTLNEQNLFITFGYRLGLHPPGVKDAKRMYEANHIANLANAKVIQAFRHYVPDGKIG
FT                   PSFAYSPMYPYDCRPENVLAWENAEEFQNHWWMDVYVWGTYPQAAWNYLEQQGWAPTIK
FT                   SGDMELLKAGKPDFMGVNYYRSQTVQYNPLDGVGEGVMNTTGKKGTSTESGIPGLFKIV
FT                   RNPHLEATNWDWEIDPVGLRIGLRRIANRYGLPVFITENGLGEFDKLEDGDIVNDDYRI
FT                   DYLRRHIQEIQRAITDGVDVIGYCTWSFTDLLSWLNGYQKRYGFVYVNRDDESEKDLRR
FT                   IKKKSFYWYKQVIASNGKEL"
     atggaacata aacaattacg tccattcccg gatcgttttt tatggggctc tgcttccgca        60
     gcgtatcaag tcgaaggcgc atggaatgaa gacggaaaag gcctgtcggt ttgggacgtt       120
     tttgccaaac agccaggcag aacgtttaaa ggaacgaacg gcgatgtcgc ggtcgatcat       180
     tatcatcgct ataaagaaga tgtggcgtta atggcggaga tggggctgaa agcataccgc       240
     ttctccgtcg catggagtcg cgtgtttcca aacgagaaag gggaaatcaa tgaaaaaggg       300
     cttcaatttt acgacaatct tatcaatgag ctgttaaaac acaatattga accgattatc       360
     accctctatc attgggacgt tccgcaggcg ttaatggacg aatatggcgc atgggagtca       420
     aggcagatca tcgatgattt ccatgattat gcggtgacgc tgtttcagcg ttttggcgac       480
     cgcgtcaaat attgggtgac gctcaacgaa caaaatcttt tcatcacatt cggctatcgg       540
     ttaggattgc atccgccagg ggtgaaagac gccaaacgca tgtatgaggc gaaccatatt       600
     gccaatttgg cgaacgccaa agtgatccaa gcgttccgcc attatgtgcc ggatggcaaa       660
     atcggcccga gcttcgccta ctcgccgatg tatccatacg attgccggcc ggaaaatgtg       720
     ctggcatggg aaaatgcgga agaatttcaa aaccattggt ggatggacgt gtatgtttgg       780
     gggacgtatc cgcaggccgc ttggaactat ctcgaacagc aaggatgggc tccgacgata       840
     aaatccggcg atatggaatt attgaaagca ggaaaaccgg attttatggg cgttaactat       900
     tatcgatcac aaacggtcca atacaatccg cttgatggtg tcggcgaagg ggtgatgaac       960
     acgaccggaa aaaaaggaac gtcgacggaa agcggaattc ctgggctatt taaaatcgtt      1020
     cgcaacccac atttagaggc gacgaattgg gactgggaaa ttgacccggt cgggcttcgc      1080
     atcggattgc gccgcattgc caaccgctac gggttgcctg ttttcattac cgaaaatggc      1140
     ctcggcgaat ttgacaagct ggaagatggc gatattgtca atgacgacta ccgcattgac      1200
     tatctccgcc gtcatattca agaaatccag cgcgcgatca ccgacggtgt cgatgtcatt      1260
     ggctattgca cgtggtcgtt taccgatctt ctcagctggc tgaacggtta tcaaaagcgg      1320
     tacgggtttg tgtatgtcaa ccgtgatgac gaatcggaaa aagacttgcg ccgtattaaa      1380
     aagaaaagct tttattggta taaacaggtg attgcttcca acggcaaaga gctgtga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page