(data stored in ACNUC7421 zone)

EMBL: CP002293.PE22

CP002293.PE22        Location/Qualifiers
FT   CDS_pept        30196..30462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0022"
FT                   /product="pro-sigmaK processing inhibitor BofA"
FT                   /note="KEGG: gwc:GWCH70_0023 pro-sigmaK processing
FT                   inhibitor BofA; TIGRFAM: pro-sigmaK processing inhibitor
FT                   BofA; PFAM: sigmaK-factor processing regulatory BofA"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72878"
FT                   /db_xref="GOA:A0A0F6BHH7"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH7"
FT                   /inference="protein motif:TFAM:TIGR02862"
FT                   /protein_id="ADP72878.1"
FT                   /translation="MEQKFAVVLSLSMIIILLLVGARLKTLKFLGYGMIKLIVGALVLF
FT                   VINAVGGTFHVHIPINFITALICGFLGIPGAAALIIIDKYIVM"
     atggaacaaa aatttgctgt tgttttgtca ttgtctatga ttattatttt attattagtg        60
     ggagcaaggt tgaaaacatt gaaattttta ggatatggaa tgataaaatt aattgttgga       120
     gcgttagttt tattcgttat caatgccgtt ggcggaacgt ttcatgttca tatccctatt       180
     aacttcatca cggcattgat atgcggattc ctcggaattc cgggggcggc agctttaatc       240
     atcattgaca agtatattgt tatgtaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page