(data stored in SCRATCH zone)

EMBL: CP002293.PE221

CP002293.PE221       Location/Qualifiers
FT   CDS_pept        256107..257123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0228"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: gwc:GWCH70_3158
FT                   periplasmic binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73077"
FT                   /db_xref="GOA:A0A0F6BI26"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI26"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADP73077.1"
FT                   /translation="MSRTWWKWVIYAGSIAALIVSASFTIYCAWKVYAYHQPGEGAAAE
FT                   AEKNAFHFVLVPEELDNDYWRLVEQGAKAAAKETGVYLEYAGPRQANIDEHIHILEKAA
FT                   ASKVDGIMTQGLTEKEFTPVINHIVEKNIPVVTIDTDAPTSKRTAYIGTDNYYAGFIAG
FT                   RALEEDMHGKANVAIITGSFTASNQQLRVQGFKDAVKEEKGIHIVAVEESHITRVQAAE
FT                   KAYNILKKHPEVNAFYGTSALDAIGIAKVVEQFHREKGTYIIGFDTLPETIRYLQKGTI
FT                   HATVVQEPYEMGYRAVKMMVDIRKGNNVPSVINTETKVIRKQDLPLRPSRNYEVNHD"
     atgagccgta catggtggaa gtgggtcatt tatgccggca gcatcgcagc gcttattgta        60
     agcgcttcct ttacgatcta ttgtgcgtgg aaagtgtatg cctatcatca gccaggtgaa       120
     ggggcagcag cggaagcgga aaaaaatgcg tttcattttg tcctcgttcc tgaagaactg       180
     gataacgatt attggcgttt agtggaacaa ggggcgaaag cagcggcaaa ggagacagga       240
     gtctatctcg aatatgccgg gccgcggcag gccaacattg atgaacatat tcatattctt       300
     gaaaaagcgg ccgcttccaa agtcgatgga attatgacac aaggattgac agaaaaagag       360
     tttactcctg tcatcaatca tatagtggaa aaaaatattc cggtggtgac gatcgacact       420
     gacgccccaa caagtaagcg cacggcctat atcgggaccg ataactatta cgccggtttt       480
     attgccggac gggcgttaga ggaagatatg cacggaaagg cgaatgtggc gattattacc       540
     ggcagcttta ctgcctccaa ccagcagctg cgcgtgcaag gatttaaaga tgcagtgaag       600
     gaagaaaaag gaattcacat cgtcgctgtt gaagagtcgc atatcacgcg cgtgcaggcg       660
     gcggaaaaag cgtacaacat tttaaaaaaa catccggaag tcaatgcatt ttacgggaca       720
     agcgcgcttg acgccattgg catcgccaag gtcgtcgagc agtttcaccg cgaaaaagga       780
     acatatatta tcggctttga tacactgccg gagacgatcc gctacttgca aaagggaacg       840
     attcatgcga ccgtggtgca ggagccgtac gaaatgggat accgcgcggt gaaaatgatg       900
     gtcgatatta ggaaaggaaa caatgtccca tcagtaatca atacggaaac gaaagtgatt       960
     cgcaagcaag atttgccgct gcgcccttcc cgcaactacg aggtgaacca tgattaa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page