(data stored in ACNUC7421 zone)

EMBL: CP002293.PE226

CP002293.PE226       Location/Qualifiers
FT   CDS_pept        262593..263414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0233"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gwc:GWCH70_3153
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73082"
FT                   /db_xref="GOA:A0A0F6BI31"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI31"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP73082.1"
FT                   /translation="MWQRAWSRLFLYAICIFMSLFFLMPVYVMLVTSVKPLDEVTLADM
FT                   WKLPSAFDWSSYQTAFAKLAPNFWNSVYLVVPATLLSAILGALNGYVLSKWKFKGADTI
FT                   FTLILFGMFIPYQSILIPLIQFLREIGLYNTIPGLIFVHVVYGIPITTLMFRNFYAAIP
FT                   DEMIESAKIDGAGFLRIFRYIMLPLSVTGFVVVAIWQFTNIWNEFLFAVTITTSSQQPI
FT                   MVALQNLSGSQIVQWNVQMAGALLAALPTLLVYIFLGKYFVRGLLAGSVKG"
     atgtggcaac gggcatggtc gaggctgttt ttatatgcca tttgcatctt catgagcctg        60
     tttttcttaa tgccggtcta tgtgatgctc gtgacaagcg tcaaaccgct ggacgaagtg       120
     acgctcgccg atatgtggaa gcttccgtcc gccttcgact ggagcagtta tcaaaccgcg       180
     tttgcgaaat tggcgccgaa cttttggaat tccgtttatt tagtggttcc ggcgacatta       240
     ttgtcggcga tattaggggc attgaacggc tacgtattgt cgaaatggaa attcaaaggg       300
     gcagatacga tttttacgct cattttgttc ggcatgttta tcccatacca aagcattttg       360
     attccgctga ttcagttttt gcgggaaatt ggtttgtata atacgattcc ggggctcatt       420
     tttgtgcatg tggtatacgg gattcccatt acgacgctga tgttccgcaa tttttacgcg       480
     gcgatcccgg atgaaatgat tgaatcggcg aaaatcgatg gcgccgggtt tttgcggatt       540
     ttccgctaca ttatgcttcc attgtccgtt accgggtttg tcgttgtagc gatttggcag       600
     tttacgaata tatggaatga atttttattt gccgtcacga tcacgacatc ttcccagcag       660
     ccgattatgg tcgcgctgca aaacttatcg ggcagccaaa ttgtgcaatg gaacgtgcaa       720
     atggcaggag cgctgctagc ggcgctgccg accttgcttg tatacatttt tcttggcaaa       780
     tacttcgttc gcggtttatt ggccggttcg gtaaaaggat aa                          822
//

If you have problems or comments...

PBIL Back to PBIL home page