(data stored in SCRATCH zone)

EMBL: CP002293.PE229

CP002293.PE229       Location/Qualifiers
FT   CDS_pept        complement(266336..267166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0236"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: bxe:Bxe_B1551 putative
FT                   outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73085"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI34"
FT                   /inference="protein motif:PFAM:PF03180"
FT                   /protein_id="ADP73085.1"
FT                   /translation="MKAHKILFSFIALAFLVLSGCSSLTQNTNSSATKTIKLGATAGPY
FT                   SDQIKKVIKPYLEKKGYKVELIEFNDYVQPNISLDQGSIDANVFQNEVYMKNFEKTRNM
FT                   ELYEVIKIPTAPIGIYSKKHKSLDEIKDGTTIALPNEPVNQARALTMLEQLGLIQLKKG
FT                   VDPIKVSERDIEKYHKKIVLKPLEPAQLPRSLGDVDYSLINGNFAISSGLKLKDAVALE
FT                   KTPPYYLNGVTVREKDKDAAFVKDIVEAYKSKEFRKLMKEDEEYQGYAWPDWFK"
     atgaaagcac ataaaatatt attttcgttc attgcgctag catttcttgt attgtcagga        60
     tgctcaagct tgacgcaaaa cacaaacagc tccgcaacga agactattaa acttggagcg       120
     acagccggac cgtatagcga tcaaataaag aaagtcataa agccttatct cgagaaaaaa       180
     ggatataaag tggaactcat tgaattcaac gattatgtcc agcctaatat ctccctagac       240
     caaggttcca tcgacgcaaa tgtatttcaa aatgaagtgt atatgaagaa ttttgaaaaa       300
     acccggaata tggaacttta tgaagtgatc aaaattccta ctgctcctat tggaatatac       360
     tccaaaaaac ataaatcatt agacgagatc aaagacggaa cgacaatcgc cttgcctaac       420
     gaaccggtaa atcaagcgcg ggctcttacg atgcttgaac aacttggatt gatccaactc       480
     aaaaaaggag tcgatccgat aaaagtatcg gaaagggata ttgaaaaata tcataaaaaa       540
     attgttttaa aacctttaga accagcacag cttccgcgct ctctcgggga tgttgattac       600
     tctttaatca atggaaattt tgctatctca tccggattaa aattgaaaga tgcagtcgca       660
     ttagaaaaaa cgcctcctta ctatttaaac ggggtgaccg tgcgagagaa agataaagat       720
     gcggcgtttg tgaaagacat cgtggaggct tataaatcaa aggaatttag aaaattaatg       780
     aaagaagatg aagaatacca aggctatgca tggcctgatt ggtttaaata a                831
//

If you have problems or comments...

PBIL Back to PBIL home page