(data stored in ACNUC7421 zone)

EMBL: CP002293.PE230

CP002293.PE230       Location/Qualifiers
FT   CDS_pept        complement(267211..267876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0237"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gtn:GTNG_1346 ABC
FT                   transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73086"
FT                   /db_xref="GOA:A0A0F6BI35"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI35"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP73086.1"
FT                   /translation="MLLDALIRLIPELNKAFLETIYMVAISLFAAVVAGLPLGILLFVT
FT                   DRGLFLENIAVKSVLGFIVNMIRSIPFIILLVGLLPLTKLITGTTIGPTAASVSLSVAA
FT                   VPFFARIVETSLREIEKGVIEAAIAVGATPWMIIKDVLLPETRPGIVHGITITTISLVG
FT                   YSAMAGIVGGGGIGDLAIRFGYYRYDNTIMITTIVILICLVQIIQFIGDRIARLVDKR"
     atgctgcttg atgcgctgat ccgcttaatt ccggaattga acaaagcgtt tttagagacg        60
     atttatatgg tggcgatctc cctttttgcc gcggttgttg ccggccttcc attaggaatt       120
     cttcttttcg tcaccgaccg cggcctgttt ttagagaaca tagcagtcaa atctgtcctt       180
     ggttttattg tcaatatgat ccgctcgata ccatttatca tcttgctcgt cgggctgctg       240
     ccgctcacga aactgattac gggaacaacg atcggcccca ccgccgcttc tgtatcttta       300
     tcggtcgctg ccgttccgtt ttttgcaaga attgttgaaa catcgctgcg ggaaatcgaa       360
     aaaggggtga tcgaagcggc aatcgccgtc ggagcgacac cgtggatgat tatcaaagat       420
     gtgcttctac cggaaacacg tcccggcatt gtgcatggaa ttacgataac aacgatcagt       480
     ttagttggat attcagcgat ggccggaatt gtcggcggcg gcggcatcgg cgatttagcg       540
     attcgtttcg gatattaccg ttatgacaac acgattatga tcacaacgat cgttatttta       600
     atttgccttg tccaaatcat tcagtttatc ggcgaccgca tcgcccgctt ggtcgataaa       660
     cggtga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page