(data stored in ACNUC7421 zone)

EMBL: CP002293.PE231

CP002293.PE231       Location/Qualifiers
FT   CDS_pept        complement(267866..268879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0238"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gtn:GTNG_1347 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; NIL domain; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73087"
FT                   /db_xref="GOA:A0A0F6BI36"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI36"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP73087.1"
FT                   /translation="MIEIKNVTKIYSTKKKQVVGVDNISLTIQDGEIFGIIGYSGAGKS
FT                   TLLRCLNLLERPTSGQVIIDGVDLTSLNDKQLRQARLKIGMIFQHFYLVSSKTVFENVA
FT                   FALKAAKKPKEEIEKRVNELLEMVGLSDKRDAYPSQLSGGQKQRVGIARALANDPTVLL
FT                   CDEATSALDPSTTKSILALLKKINRELGITIVLITHEMEVVKEICDRVAVMQNGRIIEL
FT                   GTVYDIFTNPQEELTKSFINSVLRFEIPDHLLQKRTGTMVKIHFKGEIAEEAVISDMLQ
FT                   SFKVKGNILHGKIEYIQEIPLGIFVMELIGEQEEIQRAIDYISQRTNALEVIAYAA"
     atgatcgaaa taaaaaatgt aacaaaaatc tattcgacga aaaaaaagca agtggtcggc        60
     gtcgacaaca tatcgttaac cattcaagac ggggagattt tcggcatcat cggctatagt       120
     ggcgccggca aaagcacgtt gctgcgctgc ttaaaccttc tggaacgccc gacatccggc       180
     caagtcatca tcgatggtgt cgatttaaca tcattgaacg acaagcagct gcggcaggcc       240
     cgtttaaaaa tcggcatgat tttccagcat ttttatctcg tcagctccaa aacggtgttt       300
     gaaaatgtcg cctttgcctt aaaagcagca aaaaagccaa aagaggaaat tgaaaaacga       360
     gtcaatgaat tgcttgaaat ggtcgggctt tccgataaac gggacgcata cccttcccag       420
     ctcagcggcg ggcaaaagca gcgggtcggc atcgcccggg cgcttgcgaa cgatccgact       480
     gtccttttat gcgacgaagc aacatcggcg ctcgacccaa gcacaacgaa atcgatttta       540
     gcgttgttga aaaaaatcaa ccgcgaactt ggcatcacga tcgtgctgat aacccatgaa       600
     atggaagtcg tcaaagagat atgcgaccgc gtcgccgtca tgcaaaacgg gagaatcatc       660
     gaattaggaa ctgtatatga tattttcacc aatccgcaag aagaattaac caagtccttt       720
     atcaacagcg ttttgcgctt tgaaatcccg gatcatctgc tgcagaagcg gacgggaacg       780
     atggtgaaaa tccacttcaa aggagagatc gccgaggaag cggtcatttc tgatatgttg       840
     caatccttta aggtaaaagg aaatattttg cacggaaaaa ttgagtatat tcaagaaata       900
     ccgcttggca tttttgtcat ggaactgatt ggcgaacaag aagagattca gcgggccatt       960
     gactacattt cgcaacgaac aaacgcgctg gaagtgatcg cctatgctgc ttga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page