(data stored in SCRATCH zone)

EMBL: CP002293.PE234

CP002293.PE234       Location/Qualifiers
FT   CDS_pept        complement(271739..272515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0241"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gtn:GTNG_2610 putative
FT                   transport system permease protein of aliphatic sulfonates
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73090"
FT                   /db_xref="GOA:A0A0F6BI39"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI39"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP73090.1"
FT                   /translation="MKKIRKIYDQIAPWIVPILLLIAWQLFSAIGWISERVLPSPLEVL
FT                   LAAITLTKNGELFTNIGVSFTRAFIGFVIGGGIGLILGLLNGIYPVAEKYLNTTIQMFR
FT                   NIPHLALIPIVILWFGVGEEAKIFLVIIGVFFPIYINTYHGVISVPKDLIEMGKVYGLS
FT                   KWILFSNVIFPSALPSILVGLRYALGVMWLTLIVAETVAASSGIGYMAMNAREFMQLDV
FT                   VVLSILLYALLGKLADSLAKCLERYFLKWNPAYQKK"
     atgaaaaaaa taaggaaaat ctacgatcag attgctccat ggatagttcc cattctgcta        60
     ttgattgctt ggcaactatt ctctgcaatc gggtggattt cagaaagagt attgccatct       120
     cctcttgaag tcttattagc ggcaataacg ttgacaaaaa atggagagtt attcacgaat       180
     ataggagtca gttttacccg tgcttttatt ggattcgtga ttggaggcgg aatcggatta       240
     attcttggat tattaaatgg aatctatcct gtagcggaaa agtatttaaa tacgacgatt       300
     caaatgtttc gcaatattcc gcatttagcc ttaattccta tcgttatttt atggtttggt       360
     gtcggagagg aagcaaaaat ttttctcgta atcattggtg tatttttccc aatttatatt       420
     aacacttacc atggcgtcat ttccgttcca aaagatttga ttgaaatggg aaaagtatat       480
     ggtctgtcta agtggatctt gttttccaat gtgattttcc ctagtgcact gccttccatt       540
     ttagttggtt tgcgttacgc ccttggcgtc atgtggctga cgctgattgt cgctgaaact       600
     gtggcagcaa gttccggaat cggatatatg gcgatgaacg cccgtgaatt catgcaattg       660
     gatgtggtgg tgttatccat cttgttatat gccctgctcg gcaagctggc agactcgctg       720
     gcaaaatgtt tagaacgata ctttcttaaa tggaatccgg catatcaaaa aaagtaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page